HNF-4 gamma/NR2A2 Antibody

Images

 
Western Blot: HNF-4 gamma/NR2A2 Antibody [NBP1-52809] - HepG2 Antibody Dilution: 1.0 ug/ml HNF4G is supported by BioGPS gene expression data to be expressed in HepG2.
Western Blot: HNF-4 gamma/NR2A2 Antibody [NBP1-52809] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related HNF-4 gamma/NR2A2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-52809
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HNF-4 gamma/NR2A2 Antibody Summary

Immunogen
Synthetic peptides corresponding to HNF4G(hepatocyte nuclear factor 4, gamma) The peptide sequence was selected from the N terminal of HNF4G. Peptide sequence MDMANYSEVLDPTYTTLEFETMQILYNSSDSSAPETSMNTTDNGVNCLCA.
Clonality
Polyclonal
Host
Rabbit
Gene
HNF4G
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HNF4G and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HNF-4 gamma/NR2A2 Antibody

  • hepatocyte nuclear factor 4, gamma
  • hepatocyte nuclear factor 4-gamma
  • HNF4 gamma
  • HNF-4 gamma
  • HNF4G
  • HNF-4-gamma
  • NR2A2
  • NR2A2Nuclear receptor subfamily 2 group A member 2
  • NR2A3

Background

HNF4 was first identified as a DNA binding activity in rat liver nuclear extracts and then was found to be an orphan member of the nuclear receptor superfamily. Binding sites for this factor were identified in many tissue-specifically expressed genes, and the protein was found to be essential for early embryonic development in the mouse

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
AF4186
Species: Hu
Applications: WB, ICC
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00001646-M03
Species: Hu
Applications: WB, ELISA
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF2400
Species: Hu
Applications: WB, ChIP, ICC
MAB6529
Species: Hu
Applications: WB, Simple Western
NBP1-31378
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-27079
Species: Hu, Ca, Pm
Applications: WB, IHC-P
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-91831
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NBP2-27196
Species: Hu, Mu, Bv, Ca, Ch, ChHa, Eq, GP, Other, Pm
Applications: WB, IHC-P
AF6014
Species: Hu, Mu, Rt
Applications: WB
NBP2-55686
Species: Hu
Applications: ICC/IF
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-52809
Species: Hu
Applications: WB

Publications for HNF-4 gamma/NR2A2 Antibody (NBP1-52809) (0)

There are no publications for HNF-4 gamma/NR2A2 Antibody (NBP1-52809).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HNF-4 gamma/NR2A2 Antibody (NBP1-52809) (0)

There are no reviews for HNF-4 gamma/NR2A2 Antibody (NBP1-52809). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HNF-4 gamma/NR2A2 Antibody (NBP1-52809) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HNF-4 gamma/NR2A2 Products

Bioinformatics Tool for HNF-4 gamma/NR2A2 Antibody (NBP1-52809)

Discover related pathways, diseases and genes to HNF-4 gamma/NR2A2 Antibody (NBP1-52809). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HNF-4 gamma/NR2A2 Antibody (NBP1-52809)

Discover more about diseases related to HNF-4 gamma/NR2A2 Antibody (NBP1-52809).
 

Pathways for HNF-4 gamma/NR2A2 Antibody (NBP1-52809)

View related products by pathway.

PTMs for HNF-4 gamma/NR2A2 Antibody (NBP1-52809)

Learn more about PTMs related to HNF-4 gamma/NR2A2 Antibody (NBP1-52809).
 

Research Areas for HNF-4 gamma/NR2A2 Antibody (NBP1-52809)

Find related products by research area.

Blogs on HNF-4 gamma/NR2A2

There are no specific blogs for HNF-4 gamma/NR2A2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HNF-4 gamma/NR2A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HNF4G
Entrez
Uniprot