HNF-4 alpha/NR2A1 Antibody

Images

 
Western Blot: HNF-4 alpha/NR2A1 Antibody [NBP1-52912] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Western Blot: HNF-4 alpha/NR2A1 Antibody [NBP1-52912] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: Hela cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HNF-4 alpha/NR2A1 Antibody Summary

Immunogen
Synthetic peptides corresponding to HNF4A(hepatocyte nuclear factor 4, alpha) The peptide sequence was selected from the middle region of HNF4A (NP_001025174). Peptide sequence LPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HNF4A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against HNF4A and was validated on Western blot.
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-52912.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HNF-4 alpha/NR2A1 Antibody

  • FLJ39654
  • hepatic nuclear factor 4 alpha
  • hepatocyte nuclear factor 4, alpha
  • hepatocyte nuclear factor 4-alpha
  • HNF4 alpha
  • HNF-4 alpha
  • HNF4A
  • HNF4a7
  • HNF-4-alpha
  • HNF4alpha10/11/12
  • HNF4HNF4a8
  • MODY
  • MODY1
  • NR2A1
  • NR2A1HNF4a9
  • NR2A21
  • Nuclear receptor subfamily 2 group A member 1
  • TCF
  • TCF14
  • TCF-14
  • TCF14HNF4alpha
  • Transcription factor 14
  • Transcription factor HNF-4
  • transcription factor-14

Background

The protein encoded by HNF4A is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF4186
Species: Hu
Applications: WB, ICC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF3287
Species: Hu, Mu, Rt
Applications: WB
AF5596
Species: Hu
Applications: WB, IHC, ICC
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
AF4885
Species: Mu
Applications: WB, IP
NBP1-52912
Species: Hu
Applications: WB

Publications for HNF-4 alpha/NR2A1 Antibody (NBP1-52912)(1)

Reviews for HNF-4 alpha/NR2A1 Antibody (NBP1-52912) (0)

There are no reviews for HNF-4 alpha/NR2A1 Antibody (NBP1-52912). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HNF-4 alpha/NR2A1 Antibody (NBP1-52912) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HNF-4 alpha/NR2A1 Products

Bioinformatics Tool for HNF-4 alpha/NR2A1 Antibody (NBP1-52912)

Discover related pathways, diseases and genes to HNF-4 alpha/NR2A1 Antibody (NBP1-52912). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HNF-4 alpha/NR2A1 Antibody (NBP1-52912)

Discover more about diseases related to HNF-4 alpha/NR2A1 Antibody (NBP1-52912).
 

Pathways for HNF-4 alpha/NR2A1 Antibody (NBP1-52912)

View related products by pathway.

PTMs for HNF-4 alpha/NR2A1 Antibody (NBP1-52912)

Learn more about PTMs related to HNF-4 alpha/NR2A1 Antibody (NBP1-52912).
 

Research Areas for HNF-4 alpha/NR2A1 Antibody (NBP1-52912)

Find related products by research area.

Blogs on HNF-4 alpha/NR2A1

There are no specific blogs for HNF-4 alpha/NR2A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HNF-4 alpha/NR2A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HNF4A
Entrez
Uniprot