HNF-4 alpha/NR2A1 Antibody (3C6)

Images

 
Western Blot: HNF-4 alpha/NR2A1 Antibody (3C6) [H00003172-M07] - Analysis of HNF4A expression in HepG2 (Cat # L019V1).
Immunocytochemistry/ Immunofluorescence: HNF-4 alpha/NR2A1 Antibody (3C6) [H00003172-M07] - Analysis of monoclonal antibody to HNF4A on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: HNF-4 alpha/NR2A1 Antibody (3C6) [H00003172-M07] - Analysis of HNF4A expression in A-431 (Cat # L015V1).
Sandwich ELISA: HNF-4 alpha/NR2A1 Antibody (3C6) [H00003172-M07] - Detection limit for recombinant GST tagged HNF4A is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3C6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HNF-4 alpha/NR2A1 Antibody (3C6) Summary

Immunogen
HNF4A (NP_000448 324 a.a. - 423 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP
Specificity
HNF4A - hepatocyte nuclear factor 4, alpha
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HNF4A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HNF-4 alpha/NR2A1 Antibody (3C6)

  • FLJ39654
  • hepatic nuclear factor 4 alpha
  • hepatocyte nuclear factor 4, alpha
  • hepatocyte nuclear factor 4-alpha
  • HNF4 alpha
  • HNF-4 alpha
  • HNF4A
  • HNF4a7
  • HNF-4-alpha
  • HNF4alpha10/11/12
  • HNF4HNF4a8
  • MODY
  • MODY1
  • NR2A1
  • NR2A1HNF4a9
  • NR2A21
  • Nuclear receptor subfamily 2 group A member 1
  • TCF
  • TCF14
  • TCF-14
  • TCF14HNF4alpha
  • Transcription factor 14
  • Transcription factor HNF-4
  • transcription factor-14

Background

The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF4186
Species: Hu
Applications: WB, ICC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF3287
Species: Hu, Mu, Rt
Applications: WB
AF5596
Species: Hu
Applications: WB, IHC, ICC
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
AF4885
Species: Mu
Applications: WB, IP
H00003172-M07
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for HNF-4 alpha/NR2A1 Antibody (H00003172-M07) (0)

There are no publications for HNF-4 alpha/NR2A1 Antibody (H00003172-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HNF-4 alpha/NR2A1 Antibody (H00003172-M07) (0)

There are no reviews for HNF-4 alpha/NR2A1 Antibody (H00003172-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HNF-4 alpha/NR2A1 Antibody (H00003172-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HNF-4 alpha/NR2A1 Products

Bioinformatics Tool for HNF-4 alpha/NR2A1 Antibody (H00003172-M07)

Discover related pathways, diseases and genes to HNF-4 alpha/NR2A1 Antibody (H00003172-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HNF-4 alpha/NR2A1 Antibody (H00003172-M07)

Discover more about diseases related to HNF-4 alpha/NR2A1 Antibody (H00003172-M07).
 

Pathways for HNF-4 alpha/NR2A1 Antibody (H00003172-M07)

View related products by pathway.

PTMs for HNF-4 alpha/NR2A1 Antibody (H00003172-M07)

Learn more about PTMs related to HNF-4 alpha/NR2A1 Antibody (H00003172-M07).
 

Research Areas for HNF-4 alpha/NR2A1 Antibody (H00003172-M07)

Find related products by research area.

Blogs on HNF-4 alpha/NR2A1

There are no specific blogs for HNF-4 alpha/NR2A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HNF-4 alpha/NR2A1 Antibody (3C6) and receive a gift card or discount.

Bioinformatics

Gene Symbol HNF4A
Entrez
OMIM
Uniprot