HNF-3 beta/FoxA2 Antibody (6G9)

Images

 
Western Blot: HNF-3 beta/FoxA2 Antibody (6G9) [H00003170-M05] - Analysis of FOXA2 expression in HepG2 (Cat # L019V1).
ELISA: HNF-3 beta/FoxA2 Antibody (6G9) [H00003170-M05] - Detection limit for recombinant GST tagged FOXA2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related HNF-3 beta/FoxA2 Primary Antibodies

Order Details


    • Catalog Number
      H00003170-M05
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HNF-3 beta/FoxA2 Antibody (6G9) Summary

Immunogen
FOXA2 (NP_068556 363 a.a. - 457 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
Specificity
FOXA2 - forkhead box A2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FOXA2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HNF-3 beta/FoxA2 Antibody (6G9)

  • forkhead box A2
  • Forkhead box protein A2
  • FoxA2
  • hepatic nuclear factor-3-beta
  • hepatocyte nuclear factor 3, beta
  • hepatocyte nuclear factor 3-beta
  • HNF3 beta
  • HNF-3 beta
  • HNF-3B
  • HNF-3-beta
  • HNF3BTCF-3B
  • MGC19807
  • TCF3B
  • Transcription factor 3B

Background

This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Two transcript variants encoding the same protein have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-55686
Species: Hu
Applications: ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-27079
Species: Hu, Ca, Pm
Applications: WB, IHC-P
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
AF1924
Species: Hu
Applications: WB, Simple Western, ChIP, ICC
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4186
Species: Hu
Applications: WB, ICC
AF6014
Species: Hu, Mu, Rt
Applications: WB
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
H00003170-M05
Species: Hu
Applications: WB, ELISA

Publications for HNF-3 beta/FoxA2 Antibody (H00003170-M05) (0)

There are no publications for HNF-3 beta/FoxA2 Antibody (H00003170-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HNF-3 beta/FoxA2 Antibody (H00003170-M05) (0)

There are no reviews for HNF-3 beta/FoxA2 Antibody (H00003170-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HNF-3 beta/FoxA2 Antibody (H00003170-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HNF-3 beta/FoxA2 Products

Bioinformatics Tool for HNF-3 beta/FoxA2 Antibody (H00003170-M05)

Discover related pathways, diseases and genes to HNF-3 beta/FoxA2 Antibody (H00003170-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HNF-3 beta/FoxA2 Antibody (H00003170-M05)

Discover more about diseases related to HNF-3 beta/FoxA2 Antibody (H00003170-M05).
 

Pathways for HNF-3 beta/FoxA2 Antibody (H00003170-M05)

View related products by pathway.

PTMs for HNF-3 beta/FoxA2 Antibody (H00003170-M05)

Learn more about PTMs related to HNF-3 beta/FoxA2 Antibody (H00003170-M05).

Blogs on HNF-3 beta/FoxA2

There are no specific blogs for HNF-3 beta/FoxA2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HNF-3 beta/FoxA2 Antibody (6G9) and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXA2
Entrez
OMIM
Uniprot