Recombinant Human HMGN2 Protein

Images

 
SDS-Page: HMGN2 Recombinant Protein [H00003151-P01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HMGN2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-90 of Human HMGN2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPKRKAEEDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
HMGN2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00003151-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HMGN2 Protein

  • High mobility group nucleosome-binding domain-containing protein 2
  • high-mobility group (nonhistone chromosomal) protein 17
  • high-mobility group nucleosomal binding domain 2
  • HMG17high mobility group protein N2
  • MGC5629
  • MGC88718
  • non-histone chromosomal protein HMG-17
  • nonhistone chromosomal protein HMG-17

Background

HMGN2( AAH14644, 1 a.a. - 91 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14842
Species: Hu, Po, Bv, Ca, Pm, Rb
Applications: WB
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-69801
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IF
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF2758
Species: Hu
Applications: WB, IHC
NB100-59840
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-90271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-56468
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, IHC-P
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NB500-101
Species: Hu, Bv
Applications: WB, Flow, ICC/IF, IP
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for HMGN2 Recombinant Protein (H00003151-P01)(1)


Showing Publication 1 - 1 of 1.
Publication using H00003151-P01 Applications Species
Bonfiglio JJ, Fontana P, Zhang Q et al. Serine ADP-Ribosylation Depends on HPF1. Mol Cell 2017 Mar 2 [PMID: 28190768]

Reviews for HMGN2 Recombinant Protein (H00003151-P01) (0)

There are no reviews for HMGN2 Recombinant Protein (H00003151-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HMGN2 Recombinant Protein (H00003151-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HMGN2 Products

Bioinformatics Tool for HMGN2 Recombinant Protein (H00003151-P01)

Discover related pathways, diseases and genes to HMGN2 Recombinant Protein (H00003151-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HMGN2 Recombinant Protein (H00003151-P01)

Discover more about diseases related to HMGN2 Recombinant Protein (H00003151-P01).
 

Pathways for HMGN2 Recombinant Protein (H00003151-P01)

View related products by pathway.

PTMs for HMGN2 Recombinant Protein (H00003151-P01)

Learn more about PTMs related to HMGN2 Recombinant Protein (H00003151-P01).

Blogs on HMGN2

There are no specific blogs for HMGN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF
HMGN2 Antibody
NBP2-57801

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HMGN2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HMGN2