Recombinant Human HMGB1/HMG-1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related HMGB1/HMG-1 Peptides and Proteins

Order Details


    • Catalog Number
      H00003146-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human HMGB1/HMG-1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-90 of Human HMGB1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFK

Protein/Peptide Type
Partial Recombinant Protein
Gene
HMGB1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HMGB1/HMG-1 Protein

  • Amphoterin
  • high mobility group box 1
  • High mobility group protein 1
  • high mobility group protein B1
  • high-mobility group (nonhistone chromosomal) protein 1
  • high-mobility group box 1
  • HMG1
  • HMG-1
  • HMG1DKFZp686A04236
  • HMG3
  • HMGB1
  • SBP-1
  • Sulfoglucuronyl carbohydrate binding protein

Background

HMGB1 - high-mobility group box 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-03950
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NBP1-69801
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IF
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
H00026959-T01
Species: Hu
NB110-41537
Species: Hu, Mu, Rt, Bv
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-84754
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC

Publications for HMGB1/HMG-1 Partial Recombinant Protein (H00003146-Q01) (0)

There are no publications for HMGB1/HMG-1 Partial Recombinant Protein (H00003146-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HMGB1/HMG-1 Partial Recombinant Protein (H00003146-Q01) (0)

There are no reviews for HMGB1/HMG-1 Partial Recombinant Protein (H00003146-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HMGB1/HMG-1 Partial Recombinant Protein (H00003146-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HMGB1/HMG-1 Products

Bioinformatics Tool for HMGB1/HMG-1 Partial Recombinant Protein (H00003146-Q01)

Discover related pathways, diseases and genes to HMGB1/HMG-1 Partial Recombinant Protein (H00003146-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HMGB1/HMG-1 Partial Recombinant Protein (H00003146-Q01)

Discover more about diseases related to HMGB1/HMG-1 Partial Recombinant Protein (H00003146-Q01).
 

Pathways for HMGB1/HMG-1 Partial Recombinant Protein (H00003146-Q01)

View related products by pathway.

PTMs for HMGB1/HMG-1 Partial Recombinant Protein (H00003146-Q01)

Learn more about PTMs related to HMGB1/HMG-1 Partial Recombinant Protein (H00003146-Q01).
 

Research Areas for HMGB1/HMG-1 Partial Recombinant Protein (H00003146-Q01)

Find related products by research area.

Blogs on HMGB1/HMG-1

There are no specific blogs for HMGB1/HMG-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HMGB1/HMG-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HMGB1
Entrez