HMGA1 Antibody


Western Blot: HMGA1 Antibody [NBP1-69222] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related HMGA1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HMGA1 Antibody Summary

Synthetic peptides corresponding to HMGA1 (high mobility group AT-hook 1) The peptide sequence was selected from the N terminal of HMGA1. Peptide sequence MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRP.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HMGA1 and was validated on Western blot.
Theoretical MW
11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
HMGA1 Lysate (NBP2-65532)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HMGA1 Antibody

  • high mobility group AT-hook 1
  • High mobility group AT-hook protein 1
  • High mobility group protein A1
  • high mobility group protein HMG-I/HMG-Y
  • High mobility group protein R
  • high-mobility group (nonhistone chromosomal) protein isoforms I and Y
  • HMGA1A
  • HMG-I(Y)
  • HMGIYMGC12816
  • HMG-R
  • MGC4242
  • MGC4854
  • nonhistone chromosomal high-mobility group protein HMG-I/HMG-Y


This gene encodes a non-histone protein involved in many cellular processes, including regulation of inducible gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of A+T-rich regions in double-stranded DNA. It has little secondary structure in solution but assumes distinct conformations when bound to substrates such as DNA or other proteins. The encoded protein is frequently acetylated and is found in the nucleus. At least seven transcript variants encoding two different isoforms have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, IP, PLA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB, PLA
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP

Publications for HMGA1 Antibody (NBP1-69222) (0)

There are no publications for HMGA1 Antibody (NBP1-69222).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HMGA1 Antibody (NBP1-69222) (0)

There are no reviews for HMGA1 Antibody (NBP1-69222). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HMGA1 Antibody (NBP1-69222) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional HMGA1 Products

Bioinformatics Tool for HMGA1 Antibody (NBP1-69222)

Discover related pathways, diseases and genes to HMGA1 Antibody (NBP1-69222). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HMGA1 Antibody (NBP1-69222)

Discover more about diseases related to HMGA1 Antibody (NBP1-69222).

Pathways for HMGA1 Antibody (NBP1-69222)

View related products by pathway.

PTMs for HMGA1 Antibody (NBP1-69222)

Learn more about PTMs related to HMGA1 Antibody (NBP1-69222).

Research Areas for HMGA1 Antibody (NBP1-69222)

Find related products by research area.

Blogs on HMGA1

There are no specific blogs for HMGA1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HMGA1 Antibody and receive a gift card or discount.


Gene Symbol HMGA1