HMGA1 Antibody

Images

 
Western Blot: HMGA1 Antibody [H00003159-B03P] - Analysis of HMGA1 expression in transfected 293T cell line. Lane 1: HMGA1 transfected lysate (11.70 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: HMGA1 Antibody [H00003159-B03P] - Analysis of purified antibody to HMGA1 on HeLa cell. Antibody concentration 10 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HMGA1 Antibody Summary

Immunogen
HMGA1 (NP_665906.1, 1 a.a. - 107 a.a.) full-length human protein. MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
HMGA1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HMGA1 Antibody

  • high mobility group AT-hook 1
  • High mobility group AT-hook protein 1
  • High mobility group protein A1
  • high mobility group protein HMG-I/HMG-Y
  • High mobility group protein R
  • high-mobility group (nonhistone chromosomal) protein isoforms I and Y
  • HMGA1A
  • HMG-I(Y)
  • HMGIYMGC12816
  • HMG-R
  • MGC4242
  • MGC4854
  • nonhistone chromosomal high-mobility group protein HMG-I/HMG-Y

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3184
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-233
Species: Hu
Applications: WB, PLA
AF5956
Species: Hu, Mu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00028996-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB100-56530
Species: Hu
Applications: WB
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP

Publications for HMGA1 Antibody (H00003159-B03P) (0)

There are no publications for HMGA1 Antibody (H00003159-B03P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HMGA1 Antibody (H00003159-B03P) (0)

There are no reviews for HMGA1 Antibody (H00003159-B03P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HMGA1 Antibody (H00003159-B03P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HMGA1 Products

Bioinformatics Tool for HMGA1 Antibody (H00003159-B03P)

Discover related pathways, diseases and genes to HMGA1 Antibody (H00003159-B03P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HMGA1 Antibody (H00003159-B03P)

Discover more about diseases related to HMGA1 Antibody (H00003159-B03P).
 

Pathways for HMGA1 Antibody (H00003159-B03P)

View related products by pathway.

PTMs for HMGA1 Antibody (H00003159-B03P)

Learn more about PTMs related to HMGA1 Antibody (H00003159-B03P).
 

Research Areas for HMGA1 Antibody (H00003159-B03P)

Find related products by research area.

Blogs on HMGA1

There are no specific blogs for HMGA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HMGA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HMGA1
Uniprot