Recombinant Human HLX1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HLX1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-104 of Human HLX1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FGIDRILSAEFDPKVKEGNTLRDLTSLLTGGRPAGVHLSGLQPSAGQFFASLDPINEASAILSPLNSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWS

Protein/Peptide Type
Partial Recombinant Protein
Gene
HLX

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HLX1 Protein

  • H2.0 (Drosophila)-like homeo box 1
  • H2.0-like homeo box 1
  • H2.0-like homeo box-1
  • H2.0-like homeobox 1
  • H2.0-like homeobox protein
  • H2.0-like homeobox
  • HB24
  • HLX1H2.0-like homeobox 1 (Drosophila)
  • Homeobox protein HB24
  • Homeobox protein HLX1

Background

HLX1 - H2.0-like homeo box 1 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-481
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-24691
Species: Hu, Mu
Applications: WB, IHC-P
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00004223-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
302-B2/CF
Species: Hu
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-33838
Species: Hu
Applications: IHC, IHC-P
NBP1-87088
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HLX1 Partial Recombinant Protein (H00003142-Q01) (0)

There are no publications for HLX1 Partial Recombinant Protein (H00003142-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLX1 Partial Recombinant Protein (H00003142-Q01) (0)

There are no reviews for HLX1 Partial Recombinant Protein (H00003142-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLX1 Partial Recombinant Protein (H00003142-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HLX1 Products

Bioinformatics Tool for HLX1 Partial Recombinant Protein (H00003142-Q01)

Discover related pathways, diseases and genes to HLX1 Partial Recombinant Protein (H00003142-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLX1 Partial Recombinant Protein (H00003142-Q01)

Discover more about diseases related to HLX1 Partial Recombinant Protein (H00003142-Q01).
 

Pathways for HLX1 Partial Recombinant Protein (H00003142-Q01)

View related products by pathway.

PTMs for HLX1 Partial Recombinant Protein (H00003142-Q01)

Learn more about PTMs related to HLX1 Partial Recombinant Protein (H00003142-Q01).

Blogs on HLX1

There are no specific blogs for HLX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF
HLX1 Antibody
NBP1-89719

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HLX1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HLX