HLA DQA2 Antibody

Images

 
Western Blot: HLA DQA2 Antibody [NBP1-89687] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: HLA DQA2 Antibody [NBP1-89687] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
Immunohistochemistry-Paraffin: HLA DQA2 Antibody [NBP1-89687] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.

Product Details

Summary
Product Discontinued
View other related HLA DQA2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-89687
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HLA DQA2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DHVASYGVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSKFPVTLG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HLA-DQA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HLA DQA2 Antibody

  • DX alpha chain
  • DX-ALPHA
  • HLA class II histocompatibility antigen, DQ alpha 2 chain
  • HLA class II histocompatibility antigen, DQ(6) alpha chain
  • HLA-DQA1
  • HLA-DXAMHC class II DQA2
  • major histocompatibility complex, class II, DQ alpha 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-14984
Species: Hu
Applications: WB, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-84549
Species: Hu
Applications: WB, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-55967
Species: Hu
Applications: ICC/IF
NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NB100-77855
Species: Hu, Bb, Ca, Pm
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-CS
NB100-2421
Species: Hu
Applications: WB, Flow, IHC, IHC-P, PEP-ELISA
H00003125-B02P
Species: Hu
Applications: WB, Flow
NBP2-53380
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NB100-63269
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IP
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF3075
Species: Hu
Applications: WB, ICC
NBP1-89687
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HLA DQA2 Antibody (NBP1-89687) (0)

There are no publications for HLA DQA2 Antibody (NBP1-89687).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DQA2 Antibody (NBP1-89687) (0)

There are no reviews for HLA DQA2 Antibody (NBP1-89687). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLA DQA2 Antibody (NBP1-89687) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HLA DQA2 Products

Bioinformatics Tool for HLA DQA2 Antibody (NBP1-89687)

Discover related pathways, diseases and genes to HLA DQA2 Antibody (NBP1-89687). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLA DQA2 Antibody (NBP1-89687)

Discover more about diseases related to HLA DQA2 Antibody (NBP1-89687).
 

Pathways for HLA DQA2 Antibody (NBP1-89687)

View related products by pathway.

Blogs on HLA DQA2

There are no specific blogs for HLA DQA2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLA DQA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-DQA2