HLA DMA Antibody


Western Blot: HLA DMA Antibody [NBP1-74130] - Titration: 1.0 ug/ml Positive Control: MCF7 Whole Cell.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

HLA DMA Antibody Summary

Synthetic peptides corresponding to the N terminal of HLA DMA. Immunizing peptide sequence GLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEW.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HLA-DMA and was validated on Western blot.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HLA DMA Antibody

  • class II histocompatibility antigen, M alpha chain
  • D6S222E
  • DMA
  • HLA class II histocompatibility antigen, DM alpha chain
  • major histocompatibility complex, class II, DM alpha
  • MHC class II antigen DMA
  • Really interesting new gene 6 protein


HLA-DMA belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta chain (DMB), both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and the cytoplasmic tail.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
Species: Hu, ArHa
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IP
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB

Publications for HLA DMA Antibody (NBP1-74130) (0)

There are no publications for HLA DMA Antibody (NBP1-74130).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DMA Antibody (NBP1-74130) (0)

There are no reviews for HLA DMA Antibody (NBP1-74130). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLA DMA Antibody (NBP1-74130) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HLA DMA Products

Bioinformatics Tool for HLA DMA Antibody (NBP1-74130)

Discover related pathways, diseases and genes to HLA DMA Antibody (NBP1-74130). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLA DMA Antibody (NBP1-74130)

Discover more about diseases related to HLA DMA Antibody (NBP1-74130).

Pathways for HLA DMA Antibody (NBP1-74130)

View related products by pathway.

PTMs for HLA DMA Antibody (NBP1-74130)

Learn more about PTMs related to HLA DMA Antibody (NBP1-74130).

Research Areas for HLA DMA Antibody (NBP1-74130)

Find related products by research area.

Blogs on HLA DMA

There are no specific blogs for HLA DMA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HLA DMA Antibody and receive a gift card or discount.


Gene Symbol HLA-DMA