Histone H3.3B Antibody (2D7-H1) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related Histone H3.3B Primary Antibodies

Order Details


    • Catalog Number
      H00003021-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Histone H3.3B Antibody (2D7-H1) [DyLight 488] Summary

Immunogen
H3F3B (AAH17558, 1 a.a. - 136 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Specificity
H3F3B - H3 histone, family 3B (H3.3B)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
H3F3B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23903189). Xenopus reactivity reported in scientific literature (PMID: 23102146). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Histone H3.3B Antibody (2D7-H1) [DyLight 488]

  • H3 histone, family 3A
  • H3 histone, family 3B (H3.3B)
  • H3.3BH3.3A
  • H3F3
  • H3F3A
  • histone H3.3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00007290-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-07996
Species: Hu
NB100-81964
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-07993
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85309
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07995
Species: Hu
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NB21-1023
Species: Hu, Mu, Ce
Applications: WB, ChIP, DB, ICC/IF
NBP2-16840
Species: Hu, Mu, Rt
Applications: WB, DB, EM, ICC/IF, IHC, IHC-Fr, IHC-P
H00008351-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-58095
Species: Hu
Applications: WB
NBP2-07994
Species: Hu
NBL1-11566
Species: Hu
NBP1-47804
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Histone H3.3B Antibody (H00003021-M01G) (0)

There are no publications for Histone H3.3B Antibody (H00003021-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histone H3.3B Antibody (H00003021-M01G) (0)

There are no reviews for Histone H3.3B Antibody (H00003021-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Histone H3.3B Antibody (H00003021-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Histone H3.3B Products

Bioinformatics Tool for Histone H3.3B Antibody (H00003021-M01G)

Discover related pathways, diseases and genes to Histone H3.3B Antibody (H00003021-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Histone H3.3B Antibody (H00003021-M01G)

Discover more about diseases related to Histone H3.3B Antibody (H00003021-M01G).
 

Pathways for Histone H3.3B Antibody (H00003021-M01G)

View related products by pathway.

Research Areas for Histone H3.3B Antibody (H00003021-M01G)

Find related products by research area.

Blogs on Histone H3.3B

There are no specific blogs for Histone H3.3B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Histone H3.3B Antibody (2D7-H1) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol H3F3B