Histone H2B Antibody (4G6)

Images

 
Immunohistochemistry-Paraffin: Histone H2B Antibody (4G6) [H00008349-M06] - Analysis of monoclonal antibody to HIST2H2BE on formalin-fixed paraffin-embedded human placenta. Antibody concentration 5 ug/ml
ELISA: Histone H2B Antibody (4G6) [H00008349-M06] - Detection limit for recombinant GST tagged HIST2H2BE is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IHC-P
Clone
4G6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Histone H2B Antibody (4G6) Summary

Immunogen
HIST2H2BE (NP_003519.1, 36 a.a. - 126 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Specificity
HIST2H2BE - histone 2, H2be (4G6)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HIST2H2BE
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Histone H2B Antibody (4G6)

  • FLJ35099
  • FLJ56780
  • FLJ56787
  • HIST1H2BK
  • histone 2, H2bf
  • histone cluster 2, H2bf
  • histone H2B type 2-F
  • Histone H2B
  • MGC131639

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a member of the histone H2B family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NLS172
Species: Hu, Rt
Applications: IHC-Fr, IHC-P
NBP1-90290
Species: Hu
Applications: IHC, IHC-P
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P

Publications for Histone H2B Antibody (H00008349-M06) (0)

There are no publications for Histone H2B Antibody (H00008349-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histone H2B Antibody (H00008349-M06) (0)

There are no reviews for Histone H2B Antibody (H00008349-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Histone H2B Antibody (H00008349-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Histone H2B Antibody (H00008349-M06)

Discover related pathways, diseases and genes to Histone H2B Antibody (H00008349-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Histone H2B Antibody (H00008349-M06)

Discover more about diseases related to Histone H2B Antibody (H00008349-M06).
 

Pathways for Histone H2B Antibody (H00008349-M06)

View related products by pathway.

PTMs for Histone H2B Antibody (H00008349-M06)

Learn more about PTMs related to Histone H2B Antibody (H00008349-M06).
 

Research Areas for Histone H2B Antibody (H00008349-M06)

Find related products by research area.

Blogs on Histone H2B

There are no specific blogs for Histone H2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Histone H2B Antibody (4G6) and receive a gift card or discount.

Bioinformatics

Gene Symbol HIST2H2BE
Entrez
Uniprot