Histone H2B Antibody (4G6)

Immunohistochemistry-Paraffin: Histone H2B Antibody (4G6) [H00008349-M06] - Analysis of monoclonal antibody to HIST2H2BE on formalin-fixed paraffin-embedded human placenta. Antibody concentration 5 ug/ml

ELISA: Histone H2B Antibody (4G6) [H00008349-M06] - Detection limit for recombinant GST tagged HIST2H2BE is approximately 3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA, IHC-P
• Clone: 4G6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

Histone H2B Antibody (4G6) Summary

• Immunogen: HIST2H2BE (NP_003519.1, 36 a.a. - 126 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
• Specificity: HIST2H2BE - histone 2, H2be (4G6)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HIST2H2BE
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry-Paraffin
• Application Notes: It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Histone H2B Antibody (4G6)

• FLJ35099
• FLJ56780
• FLJ56787
• HIST1H2BK
• histone 2, H2bf
• histone cluster 2, H2bf
• histone H2B type 2-F
• Histone H2B
• MGC131639

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a member of the histone H2B family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HIST2H2BE
• Entrez:
  • 8349(Human)
• Uniprot:
  • NP_003519(Human)