Histone H2B Antibody (4G6) Summary
| Immunogen |
HIST2H2BE (NP_003519.1, 36 a.a. - 126 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK |
| Specificity |
HIST2H2BE - histone 2, H2be (4G6) |
| Isotype |
IgG2b Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
HIST2H2BE |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunohistochemistry-Paraffin
|
| Application Notes |
It has been used for ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Histone H2B Antibody (4G6)
Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a member of the histone H2B family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC
Species: Hu, Rt
Applications: IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, IHC-P
Publications for Histone H2B Antibody (H00008349-M06) (0)
There are no publications for Histone H2B Antibody (H00008349-M06).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Histone H2B Antibody (H00008349-M06) (0)
There are no reviews for Histone H2B Antibody (H00008349-M06).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
- 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Histone H2B Antibody (H00008349-M06) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Array Products
Bioinformatics Tool for Histone H2B Antibody (H00008349-M06)
Discover related pathways, diseases and genes to Histone H2B Antibody (H00008349-M06). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Histone H2B Antibody (H00008349-M06)
Discover more about diseases related to Histone H2B Antibody (H00008349-M06).
| | Pathways for Histone H2B Antibody (H00008349-M06)
View related products by pathway.
|
PTMs for Histone H2B Antibody (H00008349-M06)
Learn more about PTMs related to Histone H2B Antibody (H00008349-M06).
| | Research Areas for Histone H2B Antibody (H00008349-M06)
Find related products by research area.
|
Blogs on Histone H2B
![Immunohistochemistry-Paraffin: Histone H2B Antibody (4G6) [H00008349-M06] - Analysis of monoclonal antibody to HIST2H2BE on formalin-fixed paraffin-embedded human placenta. Antibody concentration 5 ug/ml](http://images.novusbio.com/fullsize2/Histone-H2B-Antibody-(4G6)-Immunohistochemistry-Paraffin-H00008349-M06-img0002.jpg "Immunohistochemistry-Paraffin: Histone H2B Antibody (4G6) [H00008349-M06] - Analysis of monoclonal antibody to HIST2H2BE on formalin-fixed paraffin-embedded human placenta. Antibody concentration 5 ug/ml")
![ELISA: Histone H2B Antibody (4G6) [H00008349-M06] - Detection limit for recombinant GST tagged HIST2H2BE is approximately 3ng/ml as a capture antibody.](http://images.novusbio.com/fullsize2/Histone-H2B-Antibody-(4G6)-ELISA-H00008349-M06-img0001.jpg "ELISA: Histone H2B Antibody (4G6) [H00008349-M06] - Detection limit for recombinant GST tagged HIST2H2BE is approximately 3ng/ml as a capture antibody.")
![Immunohistochemistry-Paraffin: NPBWR1 Antibody [NLS172] - Anti-NPBWR1 / GPR7 antibody IHC of human Skin, Melanoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.](http://images.novusbio.com/fullsize2/NPBWR1-Antibody-Immunohistochemistry-Paraffin-NLS172-img0003.jpg)
![Immunohistochemistry-Paraffin: NPBWR1 Antibody [NLS172] - Analysis of anti-NPBWR1 / GPR7 antibody with human brain, pituitary.](http://images.novusbio.com/fullsize2/NPBWR1-Antibody-Immunohistochemistry-Paraffin-NLS172-img0001.jpg)
![Immunohistochemistry-Paraffin: NPBWR1 Antibody [NLS172] - Analysis of anti-NPBWR1 / GPR7 antibody with human brain, glioblastoma.](http://images.novusbio.com/fullsize2/NPBWR1-Antibody-Immunohistochemistry-Paraffin-NLS172-img0002.jpg)
![Immunohistochemistry: ABHD9 Antibody [NBP1-90290] - Staining of human duodenum shows distinct membranous and nuclear staining combined with weaker cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/ABHD9-Antibody-Immunohistochemistry-NBP1-90290-img0003.jpg)