Histamine H2 R Antibody


Immunohistochemistry-Paraffin: Histamine H2 R Antibody [NBP1-86082] - Rat liver. 1:100 antibody dilution. Citrate buffer antigen retrieval. Image from verified customer review.
Immunohistochemistry-Paraffin: Histamine H2 R Antibody [NBP1-86082] - Staining of human small intestine shows strong cytoplasmic positivity in few glandular cells.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

Histamine H2 R Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
Specificity of human Histamine H2 R antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Histamine H2 R Protein (NBP1-86082PEP)
Reviewed Applications
Read 1 Review rated 4
NBP1-86082 in the following applications:

Read Publication using
NBP1-86082 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Histamine H2 R Antibody

  • Gastric Receptor 1
  • Gastric receptor I
  • H2R
  • HH2R
  • Histamine H2 R
  • histamine H2 receptor
  • Histamine H2R
  • histamine receptor H2
  • HRH2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB

Publications for Histamine H2 R Antibody (NBP1-86082)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC-P.

Filter By Application
All Applications
Filter By Species
All Species

Review for Histamine H2 R Antibody (NBP1-86082) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using NBP1-86082:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Histamine H2 R NBP1-86082
reviewed by:
Mozhdeh Sojoodi
IHC-P Rat 05/04/2018


Sample TestedLiver


Comments1:100 dilution
Incubation:Overnight, 4 C
Citrate buffer Antigen retrieval

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Histamine H2 R Antibody (NBP1-86082) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Histamine H2 R Products

Bioinformatics Tool for Histamine H2 R Antibody (NBP1-86082)

Discover related pathways, diseases and genes to Histamine H2 R Antibody (NBP1-86082). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Histamine H2 R Antibody (NBP1-86082)

Discover more about diseases related to Histamine H2 R Antibody (NBP1-86082).

Pathways for Histamine H2 R Antibody (NBP1-86082)

View related products by pathway.

PTMs for Histamine H2 R Antibody (NBP1-86082)

Learn more about PTMs related to Histamine H2 R Antibody (NBP1-86082).

Research Areas for Histamine H2 R Antibody (NBP1-86082)

Find related products by research area.

Blogs on Histamine H2 R

There are no specific blogs for Histamine H2 R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Mozhdeh Sojoodi
Application: IHC-P
Species: Rat


Gene Symbol HRH2