Recombinant Human HIST2H3A Protein

Images

 
SDS-Page: Recombinant Human HIST2H3A Protein [H00333932-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE

Order Details

Recombinant Human HIST2H3A Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 136 of Human HIST2H3A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Protein/Peptide Type
Recombinant Protein
Gene
HIST2H3A

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HIST2H3A Protein

  • H3/n
  • H3/o
  • H3F2
  • H3FM
  • HIST2H3C
  • HIST2H3D
  • histone 2, H3a
  • histone cluster 2, H3a
  • histone H3.2
  • Histone H3/m
  • Histone H3/o

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated; this record represents the centromeric copy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-81964
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-07993
Species: Hu
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBL1-11569
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NBP2-07994
Species: Hu
NBL1-11566
Species: Hu
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-56530
Species: Hu
Applications: WB
NBP2-16840
Species: Hu, Mu, Rt
Applications: WB, DB, EM, ICC/IF, IHC, IHC-Fr, IHC-P
H00008351-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P

Publications for HIST2H3A Recombinant Protein (H00333932-P01) (0)

There are no publications for HIST2H3A Recombinant Protein (H00333932-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIST2H3A Recombinant Protein (H00333932-P01) (0)

There are no reviews for HIST2H3A Recombinant Protein (H00333932-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HIST2H3A Recombinant Protein (H00333932-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HIST2H3A Products

Bioinformatics Tool for HIST2H3A Recombinant Protein (H00333932-P01)

Discover related pathways, diseases and genes to HIST2H3A Recombinant Protein (H00333932-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on HIST2H3A

There are no specific blogs for HIST2H3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HIST2H3A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HIST2H3A