HIST1H3D Antibody (1D8) [PerCP]



Product Details

Product Discontinued
View other related HIST1H3D Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HIST1H3D Antibody (1D8) [PerCP] Summary

HIST1H3D (NP_003521, 1 a.a. - 60 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
HIST1H3D (1D8)
IgG3 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Store at 4C in the dark.
0.05% Sodium Azide
IgG purified


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HIST1H3D Antibody (1D8) [PerCP]

  • H3 histone family, member L
  • H3/l
  • H3FA
  • H3FB
  • H3FC
  • H3FD
  • H3FF
  • H3FH
  • H3FI
  • H3FJ
  • H3FK
  • HIST1H3A
  • HIST1H3C
  • HIST1H3D
  • HIST1H3F
  • HIST1H3G
  • HIST1H3H
  • HIST1H3I
  • HIST1H3J
  • histone 1, H3b
  • histone cluster 1, H3b
  • histone H3.1
  • Histone H3/a
  • Histone H3/b
  • Histone H3/c
  • Histone H3/d
  • Histone H3/f
  • Histone H3/h
  • Histone H3/i
  • Histone H3/j
  • Histone H3/k
  • Histone H3/l


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Ce
Applications: WB, ChIP, DB, ICC/IF
Species: Hu
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Xp
Applications: WB, ELISA, ICC/IF, IHC-P, KO
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: ELISA, IHC-P
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for HIST1H3D Antibody (H00008351-M01PCP) (0)

There are no publications for HIST1H3D Antibody (H00008351-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIST1H3D Antibody (H00008351-M01PCP) (0)

There are no reviews for HIST1H3D Antibody (H00008351-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HIST1H3D Antibody (H00008351-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HIST1H3D Products

Bioinformatics Tool for HIST1H3D Antibody (H00008351-M01PCP)

Discover related pathways, diseases and genes to HIST1H3D Antibody (H00008351-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HIST1H3D Antibody (H00008351-M01PCP)

Discover more about diseases related to HIST1H3D Antibody (H00008351-M01PCP).

Pathways for HIST1H3D Antibody (H00008351-M01PCP)

View related products by pathway.

PTMs for HIST1H3D Antibody (H00008351-M01PCP)

Learn more about PTMs related to HIST1H3D Antibody (H00008351-M01PCP).

Blogs on HIST1H3D

There are no specific blogs for HIST1H3D, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HIST1H3D Antibody (1D8) [PerCP] and receive a gift card or discount.


Gene Symbol HIST1H3D