Recombinant Human HIST1H2AC Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HIST1H2AC Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-130 of Human HIST1H2AC full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
HIST1H2AC

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00008334-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HIST1H2AC Protein

  • dJ221C16.4
  • H2A/l
  • H2AFLmember L
  • histone 1, H2ac
  • histone cluster 1, H2ac
  • histone H2A type 1-C
  • Histone H2A/l
  • histone H2AC
  • MGC99519

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H2A family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2110
Species: Hu
Applications: WB, IP
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
H00004751-M11
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NB300-133
Species: Hu, Mu, Rt, Po, Av, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89657
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49202
Species: Hu
Applications: IHC
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-51599
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NBP2-07991
Species: Hu
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-07988
Species: Hu
NBP1-84270
Species: Hu
Applications: IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
AF2958
Species: Hu
Applications: WB

Publications for HIST1H2AC Recombinant Protein (H00008334-P01)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for HIST1H2AC Recombinant Protein (H00008334-P01) (0)

There are no reviews for HIST1H2AC Recombinant Protein (H00008334-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HIST1H2AC Recombinant Protein (H00008334-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HIST1H2AC Products

Bioinformatics Tool for HIST1H2AC Recombinant Protein (H00008334-P01)

Discover related pathways, diseases and genes to HIST1H2AC Recombinant Protein (H00008334-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HIST1H2AC Recombinant Protein (H00008334-P01)

Discover more about diseases related to HIST1H2AC Recombinant Protein (H00008334-P01).
 

Pathways for HIST1H2AC Recombinant Protein (H00008334-P01)

View related products by pathway.

Research Areas for HIST1H2AC Recombinant Protein (H00008334-P01)

Find related products by research area.

Blogs on HIST1H2AC

There are no specific blogs for HIST1H2AC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMP-6 [Unconjugated]
507-BP-020/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HIST1H2AC Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HIST1H2AC