HIPK1 Antibody


Western Blot: HIPK1 Antibody [NBP1-52963] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related HIPK1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HIPK1 Antibody Summary

Synthetic peptides corresponding to HIPK1(homeodomain interacting protein kinase 1) The peptide sequence was selected from the middle region of HIPK1. Peptide sequence PLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HIPK1 and was validated on Western blot.
Theoretical MW
131 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HIPK1 Antibody

  • EC
  • HIPK1
  • homeodomain interacting protein kinase 1
  • homeodomain interacting protein kinase 1-like protein
  • homeodomain-interacting protein kinase 1
  • KIAA0630MGC26642
  • MGC33446
  • MGC33548
  • Myak
  • Nbak2
  • nuclear body associated kinase 2b


HIPK1 may play a role as a corepressor for homeodomain transcription factors. HIPK1 phosphorylates DAXX in response to stress, and mediates its translocation from the nucleus to the cytoplasm. HIPK1 may be involved in malignant squamous cell tumor formation.The protein encoded by this gene belongs to the Ser/Thr family of protein kinases and HIPK subfamily. It phosphorylates homeodomain transcription factors and may also function as a co-repressor for homeodomain transcription factors. Alternative splicing results in four transcript variants encoding four distinct isoforms.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC-P, ICC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB

Publications for HIPK1 Antibody (NBP1-52963) (0)

There are no publications for HIPK1 Antibody (NBP1-52963).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIPK1 Antibody (NBP1-52963) (0)

There are no reviews for HIPK1 Antibody (NBP1-52963). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HIPK1 Antibody (NBP1-52963) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HIPK1 Products

Bioinformatics Tool for HIPK1 Antibody (NBP1-52963)

Discover related pathways, diseases and genes to HIPK1 Antibody (NBP1-52963). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HIPK1 Antibody (NBP1-52963)

Discover more about diseases related to HIPK1 Antibody (NBP1-52963).

Pathways for HIPK1 Antibody (NBP1-52963)

View related products by pathway.

PTMs for HIPK1 Antibody (NBP1-52963)

Learn more about PTMs related to HIPK1 Antibody (NBP1-52963).

Research Areas for HIPK1 Antibody (NBP1-52963)

Find related products by research area.

Blogs on HIPK1

There are no specific blogs for HIPK1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HIPK1 Antibody and receive a gift card or discount.


Gene Symbol HIPK1