HIP2 Antibody


Western Blot: HIP2 Antibody [NBP1-54896] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related HIP2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HIP2 Antibody Summary

Synthetic peptides corresponding to UBE2K(ubiquitin-conjugating enzyme E2K (UBC1 homolog, yeast)) The peptide sequence was selected from the middle region of UBE2K. Peptide sequence QTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVET.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against UBE2K and was validated on Western blot.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HIP2 Antibody

  • DKFZp564C1216
  • DKFZp686J24237
  • E2(25K)
  • E2-25K
  • EC
  • HIP-2
  • huntingtin interacting protein 2
  • Huntingtin-interacting protein 2
  • HYPG
  • Ubiquitin carrier protein
  • ubiquitin-conjugating enzyme E2 K
  • Ubiquitin-conjugating enzyme E2(25K)
  • Ubiquitin-conjugating enzyme E2-25 kDa
  • Ubiquitin-conjugating enzyme E2-25K
  • ubiquitin-conjugating enzyme E2K (UBC1 homolog, yeast)
  • Ubiquitin-protein ligase


UBE2K belongs to the ubiquitin-conjugating enzyme family. This protein interacts with RING finger proteins, and it can ubiquitinate huntingtin, the gene product for Huntington's disease. Known functions for this protein include a role in aggregate formation of expanded polyglutamine proteins and the suppression of apoptosis in polyglutamine diseases, a role in the dislocation of newly synthesized MHC class I heavy chains from the endoplasmic reticulum, and involvement in foam cell formation. The protein encoded by this gene belongs to the ubiquitin-conjugating enzyme family. This protein interacts with RING finger proteins, and it can ubiquitinate huntingtin, the gene product for Huntington's disease. Known functions for this protein include a role in aggregate formation of expanded polyglutamine proteins and the suppression of apoptosis in polyglutamine diseases, a role in the dislocation of newly synthesized MHC class I heavy chains from the endoplasmic reticulum, and involvement in foam cell formation. Multiple transcript variants encoding different isoforms have been identified for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Ca
Applications: WB, Flow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for HIP2 Antibody (NBP1-54896) (0)

There are no publications for HIP2 Antibody (NBP1-54896).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIP2 Antibody (NBP1-54896) (0)

There are no reviews for HIP2 Antibody (NBP1-54896). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HIP2 Antibody (NBP1-54896) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HIP2 Products

Bioinformatics Tool for HIP2 Antibody (NBP1-54896)

Discover related pathways, diseases and genes to HIP2 Antibody (NBP1-54896). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HIP2 Antibody (NBP1-54896)

Discover more about diseases related to HIP2 Antibody (NBP1-54896).

Pathways for HIP2 Antibody (NBP1-54896)

View related products by pathway.

PTMs for HIP2 Antibody (NBP1-54896)

Learn more about PTMs related to HIP2 Antibody (NBP1-54896).

Blogs on HIP2

There are no specific blogs for HIP2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HIP2 Antibody and receive a gift card or discount.


Gene Symbol UBE2K