Recombinant Human HIN-1/SCGB3A1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related HIN-1/SCGB3A1 Peptides and Proteins

Order Details


    • Catalog Number
      H00092304-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human HIN-1/SCGB3A1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 104 of Human SCGB3A1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLLLSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGALTVFG

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SCGB3A1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HIN-1/SCGB3A1 Protein

  • cytokine high in normal-1
  • Cytokine HIN-1
  • High in normal 1
  • HIN1
  • HIN-1
  • HIN1Pneumo secretory protein 2
  • LU105
  • PNSP2
  • PnSP-2
  • PnSP-2Uteroglobin-related protein 2
  • SCGB3A1
  • secretoglobin family 3A member 1
  • secretoglobin, family 3A, member 1
  • UGRP2
  • UGRP2MGC87867

Background

SCGB3A1( AAH29176, 1 a.a. - 105 a.a.) recombinant protein with GST tag.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF3465
Species: Mu
Applications: WB
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB4218
Species: Hu
Applications: WB, IHC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15142
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HIN-1/SCGB3A1 Recombinant Protein (H00092304-P01) (0)

There are no publications for HIN-1/SCGB3A1 Recombinant Protein (H00092304-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIN-1/SCGB3A1 Recombinant Protein (H00092304-P01) (0)

There are no reviews for HIN-1/SCGB3A1 Recombinant Protein (H00092304-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HIN-1/SCGB3A1 Recombinant Protein (H00092304-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HIN-1/SCGB3A1 Products

Bioinformatics Tool for HIN-1/SCGB3A1 Recombinant Protein (H00092304-P01)

Discover related pathways, diseases and genes to HIN-1/SCGB3A1 Recombinant Protein (H00092304-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HIN-1/SCGB3A1 Recombinant Protein (H00092304-P01)

Discover more about diseases related to HIN-1/SCGB3A1 Recombinant Protein (H00092304-P01).
 

Pathways for HIN-1/SCGB3A1 Recombinant Protein (H00092304-P01)

View related products by pathway.

PTMs for HIN-1/SCGB3A1 Recombinant Protein (H00092304-P01)

Learn more about PTMs related to HIN-1/SCGB3A1 Recombinant Protein (H00092304-P01).
 

Research Areas for HIN-1/SCGB3A1 Recombinant Protein (H00092304-P01)

Find related products by research area.

Blogs on HIN-1/SCGB3A1

There are no specific blogs for HIN-1/SCGB3A1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HIN-1/SCGB3A1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SCGB3A1
Entrez