him-17 Antibody

Images

 
Immunoprecipitation: him-17 Antibody [29450002] - IP analysis of HIM17 in Hela whole cell lysate. Image courtesy of anonymous customer product review.

Product Details

Summary
Reactivity Hu, CeSpecies Glossary
Applications ELISA, ICC/IF, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

him-17 Antibody Summary

Immunogen
In vivo generated recombinant protein fragment
Epitope
RKLDDDESNDVGAYFEDDNQQGTSYRTPFMPSHLGLIQDQSPDLTMKDLFNRKRSRPQSTGFIDHSQARYYDRYKQQEYTRRNDFMKYCHVCRKKTVGKL
Specificity
Caenorhabditis elegans HIM17
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
  • Immunoprecipitation 1:10-1:500
Application Notes
This product is useful for ELISA and for Immunofluorescence. Use in immunoprecipitation reported by customer review. Use in Human reported in customer review
Reviewed Applications
Read 1 Review rated 5
using
29450002 in the following applications:

Reactivity Notes

Caenorhabditis elegans. Cross reactivity in human samples reported in customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for him-17 Antibody

  • him-17

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Supplier Logo

Publications for him-17 Antibody (29450002) (0)

There are no publications for him-17 Antibody (29450002).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for him-17 Antibody (29450002) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: IP.

Reviews using 29450002:
Filter by Applications
IP
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunoprecipitation him-17 29450002
Enlarge
reviewed by:
Western Forte
IP Human 06/12/2012
View

Summary

ApplicationImmunoprecipitation
Sample TestedHela whole cell lysate
SpeciesHuman
LotG3048-006

Blocking

Blocking DetailsBlocked with 3% Milk

Primary Anitbody

Dilution Ratio1:200

Secondary Antibody

Secondary DescriptionGoat Anti-Rabbit HRP
Secondary Manufacturer Cat#29450002

Details

Detection NotesECL
Immunoprecipitation DetailsProtein A beads, washed 5X with commercial IP buffer (Invitrogen)
Elution Descriptioneluted in SDS buffer and boiled for 5 minutes

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for him-17 Antibody (29450002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional him-17 Products

him-17 29450002

Research Areas for him-17 Antibody (29450002)

Find related products by research area.

Blogs on him-17

There are no specific blogs for him-17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Western Forte
06/12/2012
Application: IP
Species: Human

Bioinformatics

Entrez
Uniprot