HIGD2B Antibody

Images

 
Immunohistochemistry-Paraffin: HIGD2B Antibody [NBP1-93695] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HIGD2B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MATLGFVTPEAPFESSKPPIFEGLSPTVYSNPEGFKEKFLRKTRENP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HIGD2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HIGD2B Protein (NBP1-93695PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HIGD2B Antibody

  • HIG1 hypoxia inducible domain family, member 2B
  • HIGD2BP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HIGD2B Antibody (NBP1-93695) (0)

There are no publications for HIGD2B Antibody (NBP1-93695).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIGD2B Antibody (NBP1-93695) (0)

There are no reviews for HIGD2B Antibody (NBP1-93695). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HIGD2B Antibody (NBP1-93695) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HIGD2B Products

Array NBP1-93695

Bioinformatics Tool for HIGD2B Antibody (NBP1-93695)

Discover related pathways, diseases and genes to HIGD2B Antibody (NBP1-93695). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on HIGD2B

There are no specific blogs for HIGD2B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HIGD2B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HIGD2B