HIC1 Antibody (2C1)

Images

 

Product Details

Summary
Product Discontinued
View other related HIC1 Primary Antibodies

Order Details


    • Catalog Number
      H00003090-M04
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HIC1 Antibody (2C1) Summary

Immunogen
HIC1 (NP_006488.2 627 a.a. - 705 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG
Specificity
HIC1 (2C1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HIC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HIC1 Antibody (2C1)

  • hic-1
  • hypermethylated in cancer 1
  • ZBTB29hypermethylated in cancer 1 protein
  • Zinc finger and BTB domain-containing protein 29
  • ZNF901

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
MAB6798
Species: Hu
Applications: WB, ICC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56552
Species: Hu
Applications: WB
AF4885
Species: Mu
Applications: WB, IP
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30083
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB3765
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56637
Species: Hu, Mu
Applications: WB

Publications for HIC1 Antibody (H00003090-M04) (0)

There are no publications for HIC1 Antibody (H00003090-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIC1 Antibody (H00003090-M04) (0)

There are no reviews for HIC1 Antibody (H00003090-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HIC1 Antibody (H00003090-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HIC1 Products

Bioinformatics Tool for HIC1 Antibody (H00003090-M04)

Discover related pathways, diseases and genes to HIC1 Antibody (H00003090-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HIC1 Antibody (H00003090-M04)

Discover more about diseases related to HIC1 Antibody (H00003090-M04).
 

Pathways for HIC1 Antibody (H00003090-M04)

View related products by pathway.

PTMs for HIC1 Antibody (H00003090-M04)

Learn more about PTMs related to HIC1 Antibody (H00003090-M04).
 

Research Areas for HIC1 Antibody (H00003090-M04)

Find related products by research area.

Blogs on HIC1

There are no specific blogs for HIC1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HIC1 Antibody (2C1) and receive a gift card or discount.

Bioinformatics

Gene Symbol HIC1
Entrez
OMIM
Uniprot