Recombinant Human hHR23A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human hHR23A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 151-250 of Human RAD23A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ

Protein/Peptide Type
Partial Recombinant Protein
Gene
RAD23A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human hHR23A Protein

  • hHR23A
  • HHR23ARAD23, yeast homolog, A
  • HR23A
  • MGC111083
  • RAD23 (S. cerevisiae) homolog A
  • RAD23 homolog A (S. cerevisiae)
  • UV excision repair protein RAD23 homolog A

Background

RAD23A - RAD23 homolog A (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45514
Species: Hu
Applications: WB, IHC
NB100-477
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF5540
Species: Mu
Applications: WB
NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00029978-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74611
Species: Hu
Applications: WB, IHC-P, IP
NBP1-56536
Species: Hu
Applications: WB, IHC, IHC-P
NB120-22104
Species: Hu, Mu, Rt
Applications: WB
NBP1-31417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47801
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-240
Species: Hu, Mu
Applications: WB, IP
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-45970
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for hHR23A Partial Recombinant Protein (H00005886-Q01) (0)

There are no publications for hHR23A Partial Recombinant Protein (H00005886-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for hHR23A Partial Recombinant Protein (H00005886-Q01) (0)

There are no reviews for hHR23A Partial Recombinant Protein (H00005886-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for hHR23A Partial Recombinant Protein (H00005886-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional hHR23A Products

Bioinformatics Tool for hHR23A Partial Recombinant Protein (H00005886-Q01)

Discover related pathways, diseases and genes to hHR23A Partial Recombinant Protein (H00005886-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for hHR23A Partial Recombinant Protein (H00005886-Q01)

Discover more about diseases related to hHR23A Partial Recombinant Protein (H00005886-Q01).
 

Pathways for hHR23A Partial Recombinant Protein (H00005886-Q01)

View related products by pathway.

PTMs for hHR23A Partial Recombinant Protein (H00005886-Q01)

Learn more about PTMs related to hHR23A Partial Recombinant Protein (H00005886-Q01).
 

Research Areas for hHR23A Partial Recombinant Protein (H00005886-Q01)

Find related products by research area.

Blogs on hHR23A

There are no specific blogs for hHR23A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human hHR23A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD23A