Recombinant Human HGD Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HGD Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-69 of Human HGD partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:CFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
HGD

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HGD Protein

  • AKU
  • EC 1.13.11.5
  • HGOFLJ94126
  • homogentisate 1,2-dioxygenase (homogentisate oxidase)
  • homogentisate 1,2-dioxygenase
  • homogentisate oxidase
  • Homogentisate oxygenase
  • Homogentisic acid oxidase
  • homogentisicase

Background

HGD - homogentisate 1,2-dioxygenase (homogentisate oxidase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-89366
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-47476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57578
Species: Hu
Applications: WB
NBP1-87349
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88036
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-53110
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-53110
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00003081-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for HGD Partial Recombinant Protein (H00003081-Q01) (0)

There are no publications for HGD Partial Recombinant Protein (H00003081-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HGD Partial Recombinant Protein (H00003081-Q01) (0)

There are no reviews for HGD Partial Recombinant Protein (H00003081-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HGD Partial Recombinant Protein (H00003081-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HGD Products

Bioinformatics Tool for HGD Partial Recombinant Protein (H00003081-Q01)

Discover related pathways, diseases and genes to HGD Partial Recombinant Protein (H00003081-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HGD Partial Recombinant Protein (H00003081-Q01)

Discover more about diseases related to HGD Partial Recombinant Protein (H00003081-Q01).
 

Pathways for HGD Partial Recombinant Protein (H00003081-Q01)

View related products by pathway.

PTMs for HGD Partial Recombinant Protein (H00003081-Q01)

Learn more about PTMs related to HGD Partial Recombinant Protein (H00003081-Q01).

Blogs on HGD

There are no specific blogs for HGD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
HGD Antibody
NBP2-33488

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HGD Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HGD