HGD Antibody (2C10)

Immunocytochemistry/Immunofluorescence: HGD Antibody (2C10) [H00003081-M09] - Analysis of monoclonal antibody to HGD on HeLa cell. Antibody concentration 10 ug/ml

Immunoprecipitation: HGD Antibody (2C10) [H00003081-M09] - Analysis of HGD transfected lysate using anti-HGD monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HGD rabbit polyclonal antibody.

Sandwich ELISA: HGD Antibody (2C10) [H00003081-M09] - Detection limit for recombinant GST tagged HGD is 1 ng/ml as a capture antibody.

Product Discontinued

HGD Antibody (2C10) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: HGD (NP_000178, 377 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN
• Specificity: HGD - homogentisate 1,2-dioxygenase (homogentisate oxidase) (2C10)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HGD
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunoprecipitation
  • Sandwich ELISA
• Application Notes: It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HGD Antibody (2C10)

• AKU
• EC 1.13.11.5
• HGOFLJ94126
• homogentisate 1,2-dioxygenase (homogentisate oxidase)
• homogentisate 1,2-dioxygenase
• homogentisate oxidase
• Homogentisate oxygenase
• Homogentisic acid oxidase
• homogentisicase

Background

Homogentisate 1,2-dioxygenase (HGD) gene mutations are the molecular cause of alkaptonuria, a rare hereditary disorder of the phenylalanine catabolism. The highest expression of HGD is in the prostate, small intestine, colon, and liver. The HGD gene contains 14 exons. Conflicting reports have placed the gene at 3q2, 3q13.3-q21, 3q21-q24, 3q21-q23, or 3q25-q26. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HGD
• Entrez:
  • 3081(Human)
• Uniprot:
  • NP_000178(Human)