HFE Antibody (1G12) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related HFE Primary Antibodies

Order Details


    • Catalog Number
      H00003077-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HFE Antibody (1G12) [DyLight 488] Summary

Immunogen
HFE (NP_000401 115 a.a. - 205 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQ
Specificity
HFE - hemochromatosis
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HFE
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HFE Antibody (1G12) [DyLight 488]

  • dJ221C16.10.1
  • hemochromatosis
  • hereditary hemochromatosis protein HLA-H
  • hereditary hemochromatosis protein
  • HH
  • high Fe
  • HLAH
  • HLA-HHFE1
  • MGC103790
  • MHC class I-like protein HFE
  • MVCD7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
MAB3120
Species: Hu
Applications: WB, Simple Western
AF3720
Species: Hu, Mu
Applications: WB, ICC
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
1705-HH/CF
Species: Hu, Mu
AF482
Species: Mu
Applications: WB, IHC
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00003077-M01G
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for HFE Antibody (H00003077-M01G) (0)

There are no publications for HFE Antibody (H00003077-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HFE Antibody (H00003077-M01G) (0)

There are no reviews for HFE Antibody (H00003077-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HFE Antibody (H00003077-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HFE Products

Bioinformatics Tool for HFE Antibody (H00003077-M01G)

Discover related pathways, diseases and genes to HFE Antibody (H00003077-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HFE Antibody (H00003077-M01G)

Discover more about diseases related to HFE Antibody (H00003077-M01G).
 

Pathways for HFE Antibody (H00003077-M01G)

View related products by pathway.

PTMs for HFE Antibody (H00003077-M01G)

Learn more about PTMs related to HFE Antibody (H00003077-M01G).

Blogs on HFE.

The role of Smoothened in pulmonary pathologies
The Hedgehog (Hh) family of secreted proteins is involved in a number of developmental processes, one of which is the development of cancer. Past data suggests that the Sonic hedgehog (Shh) receptor is composed of two transmembrane proteins, Patche...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HFE Antibody (1G12) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol HFE