HEY2 Antibody

Images

 
Western Blot: HEY2 Antibody [NBP1-88629] - Analysis in control (vector only transfected HEK293T lysate) and hEY2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: HEY2 Antibody [NBP1-88629] - Staining of human fallopian tube shows strong positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HEY2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YLSSVEGLDSSDPLRVRLVSHLSTCATQREAAAMTSSMAHHHHPLHPHHWAAAFHHLPAALLQPN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HEY2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
Artery Lysate (NB820-59344)
Control Peptide
HEY2 Protein (NBP1-88629PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HEY2 Antibody

  • BHLHB32
  • bHLHb32HES-related repressor protein 2
  • cardiovascular basic helix-loop-helix factor 1
  • Cardiovascular helix-loop-helix factor 1
  • CHF1
  • Class B basic helix-loop-helix protein 32
  • GRLGRIDLOCK
  • Hairy and enhancer of split-related protein 2
  • hairy/enhancer-of-split related with YRPW motif 2
  • hairy/enhancer-of-split related with YRPW motif protein 2
  • Hairy-related transcription factor 2
  • hCHF1
  • HERP
  • HERP1hHRT2
  • HESR2
  • HESR-2
  • HES-related repressor protein 1
  • HRT2
  • HRT-2
  • MGC10720
  • Protein gridlock homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27152
Species: Mu
Applications: WB
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-45970
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00026508-M07
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF4079
Species: Hu
Applications: WB, ICC
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-85594
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1389
Species: Mu
Applications: WB, ICC
H00004854-M01
Species: Hu
Applications: WB, ELISA
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NBP2-41305
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83957
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for HEY2 Antibody (NBP1-88629) (0)

There are no publications for HEY2 Antibody (NBP1-88629).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HEY2 Antibody (NBP1-88629) (0)

There are no reviews for HEY2 Antibody (NBP1-88629). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HEY2 Antibody (NBP1-88629) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional HEY2 Products

Bioinformatics Tool for HEY2 Antibody (NBP1-88629)

Discover related pathways, diseases and genes to HEY2 Antibody (NBP1-88629). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HEY2 Antibody (NBP1-88629)

Discover more about diseases related to HEY2 Antibody (NBP1-88629).
 

Pathways for HEY2 Antibody (NBP1-88629)

View related products by pathway.

PTMs for HEY2 Antibody (NBP1-88629)

Learn more about PTMs related to HEY2 Antibody (NBP1-88629).
 

Research Areas for HEY2 Antibody (NBP1-88629)

Find related products by research area.

Blogs on HEY2

There are no specific blogs for HEY2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HEY2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HEY2