Recombinant Human Hexokinase 2 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Hexokinase 2 Peptides and Proteins

Order Details


    • Catalog Number
      H00003099-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Hexokinase 2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human HK2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:IVKEVCTVVARRAAQLCGAGMAAVVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKGAALITAVACRIREAGQR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
HK2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00003099-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Hexokinase 2 Protein

  • DKFZp686M1669
  • EC 2.7.1
  • Hexokinase 2
  • Hexokinase type II
  • HK2
  • HKII
  • HXK2
  • Muscle form hexokinase
  • muscle

Background

Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-85789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4104
Species: Hu
Applications: WB, IP, Neut
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2337
Species: Hu
Applications: WB, IP
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-38799
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89691
Species: Hu
Applications: IHC, IHC-P
NBP1-81743
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81745
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-20881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Hexokinase 2 Partial Recombinant Protein (H00003099-Q01)(1)


Reviews for Hexokinase 2 Partial Recombinant Protein (H00003099-Q01) (0)

There are no reviews for Hexokinase 2 Partial Recombinant Protein (H00003099-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hexokinase 2 Partial Recombinant Protein (H00003099-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hexokinase 2 Products

Bioinformatics Tool for Hexokinase 2 Partial Recombinant Protein (H00003099-Q01)

Discover related pathways, diseases and genes to Hexokinase 2 Partial Recombinant Protein (H00003099-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hexokinase 2 Partial Recombinant Protein (H00003099-Q01)

Discover more about diseases related to Hexokinase 2 Partial Recombinant Protein (H00003099-Q01).
 

Pathways for Hexokinase 2 Partial Recombinant Protein (H00003099-Q01)

View related products by pathway.

PTMs for Hexokinase 2 Partial Recombinant Protein (H00003099-Q01)

Learn more about PTMs related to Hexokinase 2 Partial Recombinant Protein (H00003099-Q01).
 

Research Areas for Hexokinase 2 Partial Recombinant Protein (H00003099-Q01)

Find related products by research area.

Blogs on Hexokinase 2

There are no specific blogs for Hexokinase 2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Hexokinase 2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HK2
Entrez