HES2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HES2 Antibody [NBP1-88628] - Staining of human cell line U-251 MG shows positivity in vesicles.
Immunohistochemistry-Paraffin: HES2 Antibody [NBP1-88628] - Staining of human lateral ventricle shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Product Discontinued
View other related HES2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-88628
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HES2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GLILPLLGREDASGWHTWLPLHAQNCFLLYIQAPEQP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HES2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10 - 1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HES2 Antibody

  • BHLHB40
  • bHLHb40Class B basic helix-loop-helix protein 40
  • hairy and enhancer of split 2 (Drosophila)
  • Hairy and enhancer of split 2
  • transcription factor HES-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-41305
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-14627
Species: Hu
Applications: IHC, IHC-P
NBP2-27152
Species: Mu
Applications: WB
NBP2-57558
Species: Hu
Applications: ICC/IF
AF3600
Species: Hu
Applications: WB, ICC
NBP1-19613
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00026508-M07
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1800
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P, IP
NBP2-27417
Species: Hu, Mu, Rt
Applications: WB
NBP2-57809
Species: Hu
Applications: ICC/IF
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
AF4079
Species: Hu
Applications: WB, ICC
NBP2-49058
Species: Hu
Applications: IHC
H00004854-M01
Species: Hu
Applications: WB, ELISA
NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-38288
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88628
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for HES2 Antibody (NBP1-88628) (0)

There are no publications for HES2 Antibody (NBP1-88628).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HES2 Antibody (NBP1-88628) (0)

There are no reviews for HES2 Antibody (NBP1-88628). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HES2 Antibody (NBP1-88628) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HES2 Products

Bioinformatics Tool for HES2 Antibody (NBP1-88628)

Discover related pathways, diseases and genes to HES2 Antibody (NBP1-88628). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HES2 Antibody (NBP1-88628)

Discover more about diseases related to HES2 Antibody (NBP1-88628).
 

Pathways for HES2 Antibody (NBP1-88628)

View related products by pathway.

PTMs for HES2 Antibody (NBP1-88628)

Learn more about PTMs related to HES2 Antibody (NBP1-88628).

Blogs on HES2

There are no specific blogs for HES2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HES2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HES2