HES-1 Antibody


Western Blot: HES-1 Antibody [NBP1-69128] - Rat Kidney lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related HES-1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HES-1 Antibody Summary

Synthetic peptides corresponding to Hes1 (hairy and enhancer of split 1 (Drosophila)) The peptide sequence was selected from the C terminal of Hes1. Peptide sequence AFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGSSLTADSMWRPWR.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Hes1 and was validated on Western blot.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HES-1 Antibody

  • BHLHB39
  • bHLHb39hairy homolog (Drosophila)
  • Class B basic helix-loop-helix protein 39
  • FLJ20408
  • Hairy and enhancer of split 1
  • hairy and enhancer of split 1, (Drosophila)
  • Hairy homolog
  • Hairy-like protein
  • HES1
  • HES-1
  • hHL
  • HL
  • HRY
  • transcription factor HES-1


Hes1 is the transcriptional repressor of genes that require a bHLH protein for their transcription. Hes1 may act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1. Hes1 binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and on E-box motifs: 5'-CANNTG-3' with low affinity.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt, Rb
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu
Applications: WB
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for HES-1 Antibody (NBP1-69128) (0)

There are no publications for HES-1 Antibody (NBP1-69128).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HES-1 Antibody (NBP1-69128) (0)

There are no reviews for HES-1 Antibody (NBP1-69128). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HES-1 Antibody (NBP1-69128) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HES-1 Products

Bioinformatics Tool for HES-1 Antibody (NBP1-69128)

Discover related pathways, diseases and genes to HES-1 Antibody (NBP1-69128). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HES-1 Antibody (NBP1-69128)

Discover more about diseases related to HES-1 Antibody (NBP1-69128).

Pathways for HES-1 Antibody (NBP1-69128)

View related products by pathway.

PTMs for HES-1 Antibody (NBP1-69128)

Learn more about PTMs related to HES-1 Antibody (NBP1-69128).

Blogs on HES-1

There are no specific blogs for HES-1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HES-1 Antibody and receive a gift card or discount.


Gene Symbol HES1