HES-1 Antibody (1A6)


Sandwich ELISA: HES-1 Antibody (1A6) [H00003280-M17] - Detection limit for recombinant GST tagged HES1 is 0.1 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

HES-1 Antibody (1A6) Summary

HES1 (NP_005515.1 201 a.a. - 280 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. APCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
HES1 (1A6)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HES-1 Antibody (1A6)

  • BHLHB39
  • bHLHb39hairy homolog (Drosophila)
  • Class B basic helix-loop-helix protein 39
  • FLJ20408
  • Hairy and enhancer of split 1
  • hairy and enhancer of split 1, (Drosophila)
  • Hairy homolog
  • Hairy-like protein
  • HES1
  • HES-1
  • hHL
  • HL
  • HRY
  • transcription factor HES-1


This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt, Rb
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu
Applications: WB
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for HES-1 Antibody (H00003280-M17) (0)

There are no publications for HES-1 Antibody (H00003280-M17).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HES-1 Antibody (H00003280-M17) (0)

There are no reviews for HES-1 Antibody (H00003280-M17). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HES-1 Antibody (H00003280-M17) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HES-1 Products

Bioinformatics Tool for HES-1 Antibody (H00003280-M17)

Discover related pathways, diseases and genes to HES-1 Antibody (H00003280-M17). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HES-1 Antibody (H00003280-M17)

Discover more about diseases related to HES-1 Antibody (H00003280-M17).

Pathways for HES-1 Antibody (H00003280-M17)

View related products by pathway.

PTMs for HES-1 Antibody (H00003280-M17)

Learn more about PTMs related to HES-1 Antibody (H00003280-M17).

Research Areas for HES-1 Antibody (H00003280-M17)

Find related products by research area.

Blogs on HES-1

There are no specific blogs for HES-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HES-1 Antibody (1A6) and receive a gift card or discount.


Gene Symbol HES1