Hepassocin/FGL1 Antibody


Western Blot: FGL1 Antibody [NBP2-14015] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: FGL1 Antibody [NBP2-14015] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Product Discontinued
View other related Hepassocin/FGL1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Hepassocin/FGL1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVID LGSKRQYADCSEIFNDGYKLSGFY
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Hepassocin/FGL1 Antibody

  • FGL1
  • fibrinogen-like 1
  • fibrinogen-like protein 1
  • Fibrinogen-like-protein 1
  • FREP1
  • Hepassocin
  • hepatocellular carcinoma-related sequence
  • Hepatocyte-derived fibrinogen-related protein 1
  • HFREP-1
  • HFREP1MGC12455
  • HP-041
  • LFIRE1
  • LFIRE-1
  • Liver fibrinogen-related protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ChIP, IP, PLA
Species: Mu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Hepassocin/FGL1 Antibody (NBP2-14015) (0)

There are no publications for Hepassocin/FGL1 Antibody (NBP2-14015).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hepassocin/FGL1 Antibody (NBP2-14015) (0)

There are no reviews for Hepassocin/FGL1 Antibody (NBP2-14015). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hepassocin/FGL1 Antibody (NBP2-14015) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Hepassocin/FGL1 Products

Bioinformatics Tool for Hepassocin/FGL1 Antibody (NBP2-14015)

Discover related pathways, diseases and genes to Hepassocin/FGL1 Antibody (NBP2-14015). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hepassocin/FGL1 Antibody (NBP2-14015)

Discover more about diseases related to Hepassocin/FGL1 Antibody (NBP2-14015).

Pathways for Hepassocin/FGL1 Antibody (NBP2-14015)

View related products by pathway.

PTMs for Hepassocin/FGL1 Antibody (NBP2-14015)

Learn more about PTMs related to Hepassocin/FGL1 Antibody (NBP2-14015).

Blogs on Hepassocin/FGL1

There are no specific blogs for Hepassocin/FGL1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Hepassocin/FGL1 Antibody and receive a gift card or discount.


Gene Symbol FGL1