Recombinant Human Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Protein

Order Details


    • Catalog Number
      H00009653-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-229 of Human HS2ST1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECW

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
HS2ST1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
0.3% NaHCO3, pH 8.0

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Protein

  • 2OST
  • 2-O-sulfotransferase
  • EC 2.8.2
  • EC 2.8.2.-
  • FLJ11317
  • heparan sulfate 2-O-sulfotransferase 1
  • HS2ST
  • HS2ST1
  • KIAA0448dJ604K5.2
  • MGC131986

Background

Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. This gene encodes a member of the heparan sulfate biosynthetic enzyme family that transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation. Two alternatively spliced transcript variants that encode different proteins have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5057
Species: Hu
Applications: WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31985
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
AF2364
Species: Hu
Applications: WB, IHC
NBP1-91875
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89383
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF238
Species: Hu
Applications: WB, Neut
NBP2-30481
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20398
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009653-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Recombinant Protein (H00009653-P01) (0)

There are no publications for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Recombinant Protein (H00009653-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Recombinant Protein (H00009653-P01) (0)

There are no reviews for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Recombinant Protein (H00009653-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Recombinant Protein (H00009653-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Products

Bioinformatics Tool for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Recombinant Protein (H00009653-P01)

Discover related pathways, diseases and genes to Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Recombinant Protein (H00009653-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Recombinant Protein (H00009653-P01)

Discover more about diseases related to Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Recombinant Protein (H00009653-P01).
 

Pathways for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Recombinant Protein (H00009653-P01)

View related products by pathway.

PTMs for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Recombinant Protein (H00009653-P01)

Learn more about PTMs related to Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Recombinant Protein (H00009653-P01).

Blogs on Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1

There are no specific blogs for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HS2ST1
Entrez