Hemogen Antibody

Images

 
Western Blot: Hemogen Antibody [NBP1-84908] - Analysis in control (vector only transfected HEK293T lysate) and HEMGN over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84908] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84908] - Analysis in human bone marrow and cerebral cortex tissues. Corresponding HEMGN RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84908] - Staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84908] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84908] - Staining of human colon shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84908] - Staining of human kidney shows no positivity in cells in tubules as expected.
Independent Antibodies: Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84908] - Staining of human bone marrow, colon, kidney and testis using Anti-HEMGN antibody (A) NBP1-84908 shows similar protein ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Hemogen Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VISVIQDHPFKMYQDMAKREDLAPKMCQEAAVPKILPCPTSEDTADLAGCSLQAYPKPDVPKGYILDTDQNPAEPEEYNETDQGI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HEMGN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Hemogen Protein (NBP1-84908PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Hemogen Antibody

  • EDAGEDAG-1
  • Erythroid differentiation-associated gene protein
  • hemogen
  • Hemopoietic gene protein
  • NDR
  • Negative differentiation regulator protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00011329-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-92435
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45983
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86636
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-61873
Species: Hu
Applications: ELISA, Flow, WB
NBP2-45267
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-02715
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-47492
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-82865
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP3-03372
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB200-197
Species: Hu, Mu
Applications: IP, WB
AF5759
Species: Hu, Mu
Applications: WB
NBP1-91978
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87833
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF933
Species: Ha, Hu, Mu, Rt
Applications: Block, Flow, IHC, IP, Simple Western, WB
352-MS/CF
Species: Hu
Applications: BA, BA
203-IL/CF
Species: Hu
Applications: BA

Publications for Hemogen Antibody (NBP1-84908) (0)

There are no publications for Hemogen Antibody (NBP1-84908).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hemogen Antibody (NBP1-84908) (0)

There are no reviews for Hemogen Antibody (NBP1-84908). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hemogen Antibody (NBP1-84908) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Hemogen Products

Bioinformatics Tool for Hemogen Antibody (NBP1-84908)

Discover related pathways, diseases and genes to Hemogen Antibody (NBP1-84908). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hemogen Antibody (NBP1-84908)

Discover more about diseases related to Hemogen Antibody (NBP1-84908).
 

Pathways for Hemogen Antibody (NBP1-84908)

View related products by pathway.

Blogs on Hemogen

There are no specific blogs for Hemogen, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hemogen Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HEMGN