Hematopoietic Prostaglandin D Synthase/HPGDS Antibody


Western Blot: HPGDS Antibody [NBP1-54624] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Hematopoietic Prostaglandin D Synthase/HPGDS Antibody Summary

Synthetic peptides corresponding to PGDS(prostaglandin D2 synthase, hematopoietic) The peptide sequence was selected from the N terminal of PGDS. Peptide sequence PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKI.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PGDS and was validated on Western blot.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody

  • EC
  • EC
  • glutathione S-transferase sigma
  • Glutathione S-transferase
  • Glutathione-dependent PGD synthase
  • Glutathione-requiring prostaglandin D synthase
  • GST class-sigma
  • GSTS
  • GSTShematopoietic prostaglandin D2 synthase
  • hematopoietic prostaglandin D synthase
  • H-PGDS
  • PGDS
  • PGDSglutathione-dependent PGD synthetase
  • Prostaglandin-H2 D-isomerase
  • PTGDS2


PGDS is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq, Fe, Pm, Rb
Applications: WB, Simple Western
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB

Publications for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-54624) (0)

There are no publications for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-54624).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-54624) (0)

There are no reviews for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-54624). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-54624) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Hematopoietic Prostaglandin D Synthase/HPGDS Products

Bioinformatics Tool for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-54624)

Discover related pathways, diseases and genes to Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-54624). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-54624)

Discover more about diseases related to Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-54624).

Pathways for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-54624)

View related products by pathway.

Blogs on Hematopoietic Prostaglandin D Synthase/HPGDS

There are no specific blogs for Hematopoietic Prostaglandin D Synthase/HPGDS, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Hematopoietic Prostaglandin D Synthase/HPGDS Antibody and receive a gift card or discount.


Gene Symbol HPGDS