Recombinant Human Helios Protein

Images

 
SDS-Page: Recombinant Human Helios Protein [H00022807-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Helios Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 298-397 of Human Helios

Source: Wheat Germ

Amino Acid Sequence: HFDMNLTYEKEAELMQSHMMDQAINNAITYLGAEALHPLMQHPPSTIAEVAPVISSAYSQVYHPNRIERPISRETADSHENNMDGPISLIRPKSRPQERE

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
IKZF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Helios Protein

  • Helios
  • IKAROS family zinc finger 2 (Helios)
  • Ikaros family zinc finger protein 2
  • IKZF2
  • MGC34330
  • subfamily 1A, 2 (Helios)
  • zinc finger DNA binding protein Helios
  • zinc finger protein Helios
  • ZNF1A2
  • ZNFN1A2

Background

ZNFN1A2 - zinc finger protein, subfamily 1A, 2 (Helios)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4984
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-24495
Species: Hu, Pm
Applications: WB, ICC/IF
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-34099
Species: Hu
Applications: IHC, IHC-P
7270-IL/CF
Species: Hu
NBP2-55305
Species: Hu
Applications: WB, ICC/IF
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KO
NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
6507-IL/CF
Species: Hu
NBP1-80021
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50028
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-81555
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Helios Partial Recombinant Protein (H00022807-Q01) (0)

There are no publications for Helios Partial Recombinant Protein (H00022807-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Helios Partial Recombinant Protein (H00022807-Q01) (0)

There are no reviews for Helios Partial Recombinant Protein (H00022807-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Helios Partial Recombinant Protein (H00022807-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Helios Partial Recombinant Protein (H00022807-Q01)

Discover related pathways, diseases and genes to Helios Partial Recombinant Protein (H00022807-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Helios Partial Recombinant Protein (H00022807-Q01)

Discover more about diseases related to Helios Partial Recombinant Protein (H00022807-Q01).
 

Pathways for Helios Partial Recombinant Protein (H00022807-Q01)

View related products by pathway.

PTMs for Helios Partial Recombinant Protein (H00022807-Q01)

Learn more about PTMs related to Helios Partial Recombinant Protein (H00022807-Q01).

Blogs on Helios

There are no specific blogs for Helios, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4
6507-IL-010/CF
Helios Antibody
NBP2-34122
IL-6 [Unconjugated]
7270-IL-025/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Helios Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IKZF2