Recombinant Human heavy chain Myosin Protein

Images

 
SDS-Page: Recombinant Human heavy chain Myosin Protein [H00004621-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human heavy chain Myosin Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2-100 of Human heavy chain Myosin

Source: Wheat Germ

Amino Acid Sequence: SSDTEMEVFGIAAPFLRKSEKERIEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAMLTHLNEP

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MYH3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00004621-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human heavy chain Myosin Protein

  • HEMHC
  • Muscle embryonic myosin heavy chain
  • MYHC-EMB
  • MYHSE1
  • Myosin heavy chain, fast skeletal muscle, embryonic
  • myosin, heavy chain 3, skeletal muscle, embryonic
  • myosin, heavy polypeptide 3, skeletal muscle, embryonic
  • myosin, skeletal, heavy chain, embryonic 1
  • myosin-3
  • SMHCEMyosin heavy chain 3

Background

Myosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP. Myosin is a hexameric protein composed of a pair of myosin heavy chains (MYH) and two pairs of nonidentical light chains. This gene is a member of the MYH family and encodes a protein with an IQ domain and a myosin head-like domain. Mutations in this gene have been associated with two congenital contracture (arthrogryposis) syndromes, Freeman-Sheldon syndrome and Sheldon-Hall syndrome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15029
Species: Hu, Mu
Applications: WB
NBP2-65541
Species: Hu
NBP2-26200
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-92534
Species: Hu
Applications: WB, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Fe, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
MAB9096
Species: Hu
Applications: WB, IHC
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NB100-65675
Species: Hu, Rt, Rb
Applications: ELISA, ICC/IF, IHC, IHC-P
H00004622-R01
Species: Hu
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NB100-74340
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
H00004621-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for heavy chain Myosin Partial Recombinant Protein (H00004621-Q01)(1)

We have publications tested in 1 application: ELISA.


Filter By Application
ELISA
(1)
All Applications
Filter By Species
All Species

Reviews for heavy chain Myosin Partial Recombinant Protein (H00004621-Q01) (0)

There are no reviews for heavy chain Myosin Partial Recombinant Protein (H00004621-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for heavy chain Myosin Partial Recombinant Protein (H00004621-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for heavy chain Myosin Partial Recombinant Protein (H00004621-Q01)

Discover related pathways, diseases and genes to heavy chain Myosin Partial Recombinant Protein (H00004621-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for heavy chain Myosin Partial Recombinant Protein (H00004621-Q01)

Discover more about diseases related to heavy chain Myosin Partial Recombinant Protein (H00004621-Q01).
 

Pathways for heavy chain Myosin Partial Recombinant Protein (H00004621-Q01)

View related products by pathway.

PTMs for heavy chain Myosin Partial Recombinant Protein (H00004621-Q01)

Learn more about PTMs related to heavy chain Myosin Partial Recombinant Protein (H00004621-Q01).

Blogs on heavy chain Myosin

There are no specific blogs for heavy chain Myosin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human heavy chain Myosin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MYH3