HE2 Antibody

Images

 
Western Blot: HE2 Antibody [NBP1-98296] - HCT15 Cell Lysate 1.0ug/ml, Gel Concentration: 10-20%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HE2 Antibody Summary

Immunogen
The immunogen for this antibody is HE2 - N-terminal region. Peptide sequence LFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLPPRT. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPAG11A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HE2 Antibody

  • EDDM2A
  • sperm associated antigen 11A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS3898
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NLS975
Species: Hu, Bt, Pm, Pm
Applications: IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92856
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-02321
Species: Hu, Mu, Rt, Po, Bt, Bv
Applications: ELISA, IHC, IHC-P
NLS1049
Species: Hu, Po, Eq, Pm, Pm
Applications: ICC/IF, IHC, IHC-P, ICC
NBP2-67130
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00005729-B01P
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-98296
Species: Hu
Applications: WB

Publications for HE2 Antibody (NBP1-98296) (0)

There are no publications for HE2 Antibody (NBP1-98296).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HE2 Antibody (NBP1-98296) (0)

There are no reviews for HE2 Antibody (NBP1-98296). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HE2 Antibody (NBP1-98296) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HE2 Products

Array NBP1-98296

Bioinformatics Tool for HE2 Antibody (NBP1-98296)

Discover related pathways, diseases and genes to HE2 Antibody (NBP1-98296). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HE2 Antibody (NBP1-98296)

Discover more about diseases related to HE2 Antibody (NBP1-98296).
 

Pathways for HE2 Antibody (NBP1-98296)

View related products by pathway.

PTMs for HE2 Antibody (NBP1-98296)

Learn more about PTMs related to HE2 Antibody (NBP1-98296).

Blogs on HE2

There are no specific blogs for HE2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HE2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPAG11A
Uniprot