HDHD1A Antibody (4F12)

Images

 
Western Blot: HDHD1A Antibody (4F12) [H00008226-M05] - Analysis of HDHD1A expression in transfected 293T cell line by HDHD1A monoclonal antibody (M05), clone 4F12. Lane 1: HDHD1A transfected lysate (Predicted MW: 23.7 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4F12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HDHD1A Antibody (4F12) Summary

Immunogen
HDHD1A (NP_036212.2, 107 a.a. - 212 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPS
Specificity
This product is specific for Human HDHD1A monoclonal antibody (M05), clone 4F12 [Gene ID: 8226].
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PUDP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HDHD1A Antibody (4F12)

  • DXF68S1E5'-PsiMPase
  • EC 3.1.3.n6
  • family with sequence similarity 16, member A, X-linked
  • GS1FAM16AX
  • haloacid dehalogenase-like hydrolase domain containing 1
  • haloacid dehalogenase-like hydrolase domain containing 1A
  • Haloacid dehalogenase-like hydrolase domain-containing protein 1
  • Haloacid dehalogenase-like hydrolase domain-containing protein 1A
  • HDHD1Apseudouridine-5'-monophosphatase
  • Protein GS1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
H00005873-M02
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi
NBP1-84958
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-92156
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45883
Species: Hu
Applications: WB, IHC
NBP2-65207
Species: Hu
NBP1-76581
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90906
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38025
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Pm
Applications: WB, Simple Western
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
H00008226-M05
Species: Hu
Applications: WB, ELISA

Publications for HDHD1A Antibody (H00008226-M05) (0)

There are no publications for HDHD1A Antibody (H00008226-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HDHD1A Antibody (H00008226-M05) (0)

There are no reviews for HDHD1A Antibody (H00008226-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HDHD1A Antibody (H00008226-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HDHD1A Products

Bioinformatics Tool for HDHD1A Antibody (H00008226-M05)

Discover related pathways, diseases and genes to HDHD1A Antibody (H00008226-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HDHD1A Antibody (H00008226-M05)

Discover more about diseases related to HDHD1A Antibody (H00008226-M05).
 

Pathways for HDHD1A Antibody (H00008226-M05)

View related products by pathway.

PTMs for HDHD1A Antibody (H00008226-M05)

Learn more about PTMs related to HDHD1A Antibody (H00008226-M05).

Blogs on HDHD1A

There are no specific blogs for HDHD1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HDHD1A Antibody (4F12) and receive a gift card or discount.

Bioinformatics

Gene Symbol PUDP
Uniprot