HDAC3 Antibody (2A3) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related HDAC3 Primary Antibodies

Order Details


    • Catalog Number
      H00008841-M03PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HDAC3 Antibody (2A3) [PerCP] Summary

Immunogen
HDAC3 (NP_003874 319 a.a. - 428 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
Specificity
HDAC3 - histone deacetylase 3 (2A3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HDAC3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HDAC3 Antibody (2A3) [PerCP]

  • EC 3.5.1.98
  • HD3RPD3-2RPD3
  • histone deacetylase 3
  • SMAP45

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2781
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-Fr
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB100-56341
Species: Hu
Applications: WB, ChIP, IP
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBL1-11569
Species: Hu
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
H00008841-M03PCP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for HDAC3 Antibody (H00008841-M03PCP) (0)

There are no publications for HDAC3 Antibody (H00008841-M03PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HDAC3 Antibody (H00008841-M03PCP) (0)

There are no reviews for HDAC3 Antibody (H00008841-M03PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HDAC3 Antibody (H00008841-M03PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HDAC3 Products

Bioinformatics Tool for HDAC3 Antibody (H00008841-M03PCP)

Discover related pathways, diseases and genes to HDAC3 Antibody (H00008841-M03PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HDAC3 Antibody (H00008841-M03PCP)

Discover more about diseases related to HDAC3 Antibody (H00008841-M03PCP).
 

Pathways for HDAC3 Antibody (H00008841-M03PCP)

View related products by pathway.

PTMs for HDAC3 Antibody (H00008841-M03PCP)

Learn more about PTMs related to HDAC3 Antibody (H00008841-M03PCP).
 

Research Areas for HDAC3 Antibody (H00008841-M03PCP)

Find related products by research area.

Blogs on HDAC3

There are no specific blogs for HDAC3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HDAC3 Antibody (2A3) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol HDAC3