HDAC3 Antibody (2A3) [Alexa Fluor® 405] Summary
Immunogen |
HDAC3 (NP_003874 319 a.a. - 428 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI |
Specificity |
HDAC3 - histone deacetylase 3 (2A3) |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
HDAC3 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot
- ELISA
- Immunocytochemistry/Immunofluorescence
|
Reactivity Notes
Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
50mM Sodium Borate |
Preservative |
0.05% Sodium Azide |
Purity |
IgG purified |
Notes
Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. This product is produced by and distributed for Abnova, a company based in Taiwan.This product is provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com.
Alternate Names for HDAC3 Antibody (2A3) [Alexa Fluor® 405]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA, CHIP-SEQ
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP, ICC
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
Species: Hu, Mu
Applications: WB, ChIP, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: ELISA, ICC/IF
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Publications for HDAC3 Antibody (H00008841-M03AF405) (0)
There are no publications for HDAC3 Antibody (H00008841-M03AF405).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HDAC3 Antibody (H00008841-M03AF405) (0)
There are no reviews for HDAC3 Antibody (H00008841-M03AF405).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
- 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HDAC3 Antibody (H00008841-M03AF405) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HDAC3 Products
Bioinformatics Tool for HDAC3 Antibody (H00008841-M03AF405)
Discover related pathways, diseases and genes to HDAC3 Antibody (H00008841-M03AF405). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for HDAC3 Antibody (H00008841-M03AF405)
Discover more about diseases related to HDAC3 Antibody (H00008841-M03AF405).
| | Pathways for HDAC3 Antibody (H00008841-M03AF405)
View related products by pathway.
|
PTMs for HDAC3 Antibody (H00008841-M03AF405)
Learn more about PTMs related to HDAC3 Antibody (H00008841-M03AF405).
| | Research Areas for HDAC3 Antibody (H00008841-M03AF405)
Find related products by research area.
|
Blogs on HDAC3