HARS Antibody (1C8) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related HARS Primary Antibodies

Order Details


    • Catalog Number
      H00003035-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HARS Antibody (1C8) [PE] Summary

Immunogen
HARS (NP_002100, 1 a.a. - 96 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPV
Specificity
HARS - histidyl-tRNA synthetase
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HARS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HARS Antibody (1C8) [PE]

  • cytoplasmic
  • EC 6.1.1.21
  • FLJ20491
  • histidine-tRNA ligase
  • histidyl-tRNA synthetase
  • histidyl-tRNA synthetase, cytoplasmic

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-38514
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP2-46004
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83288
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6898
Species: Hu, Mu, Rt
Applications: WB
NBP2-38126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-86170
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20567
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-38035
Species: Hu
Applications: IHC, IHC-P
H00003035-M01PE
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for HARS Antibody (H00003035-M01PE) (0)

There are no publications for HARS Antibody (H00003035-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HARS Antibody (H00003035-M01PE) (0)

There are no reviews for HARS Antibody (H00003035-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HARS Antibody (H00003035-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HARS Products

Bioinformatics Tool for HARS Antibody (H00003035-M01PE)

Discover related pathways, diseases and genes to HARS Antibody (H00003035-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HARS Antibody (H00003035-M01PE)

Discover more about diseases related to HARS Antibody (H00003035-M01PE).
 

Pathways for HARS Antibody (H00003035-M01PE)

View related products by pathway.

Blogs on HARS

There are no specific blogs for HARS, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HARS Antibody (1C8) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol HARS