HAI-2/SPINT2 Antibody

Images

 
Western Blot: SPINT2 Antibody [NBP1-69484] - This Anti-SPINT2 antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Product Discontinued
View other related HAI-2/SPINT2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69484
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HAI-2/SPINT2 Antibody Summary

Immunogen
Synthetic peptides corresponding to SPINT2(serine peptidase inhibitor, Kunitz type, 2) The peptide sequence was selected from the middle region of SPINT2. Peptide sequence MLRCFRQQENPPLPLGSKVVVLAGLFVMVLILFLGASMVYLIRVARRNQE.
Clonality
Polyclonal
Host
Rabbit
Gene
SPINT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SPINT2 and was validated on Western blot.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HAI-2/SPINT2 Antibody

  • HAI2
  • HAI-2
  • HAI-2DIAR3
  • HAI2FLJ45571
  • Hepatocyte growth factor activator inhibitor type 2
  • Kop
  • kunitz-type protease inhibitor 2
  • PB
  • Placental bikunin
  • serine peptidase inhibitor, Kunitz type, 2
  • serine protease inhibitor, Kunitz type, 2

Background

HAI-2 (SPINT2) is a candidate tumour suppressor gene that is frequently hypermethylated and underexpressed in human HCCs, and the KD-1 domain of HAI-2 is the key region responsible for its anti-invasive function. It is also implicated in human cervical cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF2009
Species: Hu
Applications: WB, IHC
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00347527-B01P
Species: Hu
Applications: WB, ELISA
MAB38461
Species: Hu
Applications: WB, IHC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for HAI-2/SPINT2 Antibody (NBP1-69484) (0)

There are no publications for HAI-2/SPINT2 Antibody (NBP1-69484).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HAI-2/SPINT2 Antibody (NBP1-69484) (0)

There are no reviews for HAI-2/SPINT2 Antibody (NBP1-69484). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HAI-2/SPINT2 Antibody (NBP1-69484) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HAI-2/SPINT2 Products

Bioinformatics Tool for HAI-2/SPINT2 Antibody (NBP1-69484)

Discover related pathways, diseases and genes to HAI-2/SPINT2 Antibody (NBP1-69484). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HAI-2/SPINT2 Antibody (NBP1-69484)

Discover more about diseases related to HAI-2/SPINT2 Antibody (NBP1-69484).
 

Pathways for HAI-2/SPINT2 Antibody (NBP1-69484)

View related products by pathway.

PTMs for HAI-2/SPINT2 Antibody (NBP1-69484)

Learn more about PTMs related to HAI-2/SPINT2 Antibody (NBP1-69484).
 

Research Areas for HAI-2/SPINT2 Antibody (NBP1-69484)

Find related products by research area.

Blogs on HAI-2/SPINT2

There are no specific blogs for HAI-2/SPINT2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HAI-2/SPINT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPINT2
Entrez
Uniprot