HAI-1/HGFA Inhibitor 1 Antibody


Western Blot: HAI-1/HGFA Inhibitor 1 Antibody [NBP1-59923] - PANC1 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: HAI-1/HGFA Inhibitor 1 Antibody [NBP1-59923] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Product Details

Product Discontinued
View other related HAI-1/HGFA Inhibitor 1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HAI-1/HGFA Inhibitor 1 Antibody Summary

Synthetic peptides corresponding to SPINT1(serine peptidase inhibitor, Kunitz type 1) The peptide sequence was selected from the middle region of SPINT1. Peptide sequence PFSEHCARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SPINT1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HAI-1/HGFA Inhibitor 1 Antibody

  • HAI
  • HAI1
  • HAI-1
  • hepatocyte growth factor activator inhibitor 1
  • Hepatocyte growth factor activator inhibitor type 1
  • kunitz-type protease inhibitor 1
  • MANSC2
  • serine peptidase inhibitor, Kunitz type 1
  • serine protease inhibitor, Kunitz type 1
  • SPINT1


The protein encoded by this gene is a member of the Kunitz family of serine protease inhibitors. The protein is a potent inhibitor specific for HGF activator and is thought to be involved in the regulation of the proteolytic activation of HGF in injured t


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
Species: Mu
Applications: WB, IHC, IP
Species: Mu
Applications: WB, IHC, Block
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, Simple Western, IHC, IP
Species: Hu
Applications: WB
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB

Publications for HAI-1/HGFA Inhibitor 1 Antibody (NBP1-59923) (0)

There are no publications for HAI-1/HGFA Inhibitor 1 Antibody (NBP1-59923).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HAI-1/HGFA Inhibitor 1 Antibody (NBP1-59923) (0)

There are no reviews for HAI-1/HGFA Inhibitor 1 Antibody (NBP1-59923). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HAI-1/HGFA Inhibitor 1 Antibody (NBP1-59923) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HAI-1/HGFA Inhibitor 1 Antibody Products

Related Products by Gene

Bioinformatics Tool for HAI-1/HGFA Inhibitor 1 Antibody (NBP1-59923)

Discover related pathways, diseases and genes to HAI-1/HGFA Inhibitor 1 Antibody (NBP1-59923). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HAI-1/HGFA Inhibitor 1 Antibody (NBP1-59923)

Discover more about diseases related to HAI-1/HGFA Inhibitor 1 Antibody (NBP1-59923).

Pathways for HAI-1/HGFA Inhibitor 1 Antibody (NBP1-59923)

View related products by pathway.

PTMs for HAI-1/HGFA Inhibitor 1 Antibody (NBP1-59923)

Learn more about PTMs related to HAI-1/HGFA Inhibitor 1 Antibody (NBP1-59923).

Blogs on HAI-1/HGFA Inhibitor 1

There are no specific blogs for HAI-1/HGFA Inhibitor 1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HAI-1/HGFA Inhibitor 1 Antibody and receive a gift card or discount.


Gene Symbol SPINT1