Recombinant Human HADHB Protein

Images

 

Product Details

Summary
Product Discontinued
View other related HADHB Peptides and Proteins

Order Details


    • Catalog Number
      H00003032-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human HADHB Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-106 of Human HADHB partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LTYPFKNLPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
HADHB

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HADHB Protein

  • 2-enoyl-Coenzyme A (CoA) hydratase, beta subunit
  • 3-ketoacyl-Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein
  • acetyl-CoA acyltransferase
  • beta subunit
  • beta-ketothiolase
  • EC 2.3.1
  • EC 2.3.1.16
  • ECHB
  • hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein), beta subunit
  • hydroxyacyl-Coenzyme A (CoA) dehydrogenase, beta subunit
  • hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit
  • MGC87480
  • mitochondrial trifunctional enzyme, beta subunit
  • mitochondrial trifunctional protein, beta subunit
  • MTPB
  • TP-beta
  • trifunctional enzyme subunit beta, mitochondrial

Background

HADHB - hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP1-87283
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31441
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP2-49154
Species: Hu
Applications: IHC
NB100-53791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-85958
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02118
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
H00003032-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for HADHB Partial Recombinant Protein (H00003032-Q01) (0)

There are no publications for HADHB Partial Recombinant Protein (H00003032-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HADHB Partial Recombinant Protein (H00003032-Q01) (0)

There are no reviews for HADHB Partial Recombinant Protein (H00003032-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HADHB Partial Recombinant Protein (H00003032-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HADHB Products

Bioinformatics Tool for HADHB Partial Recombinant Protein (H00003032-Q01)

Discover related pathways, diseases and genes to HADHB Partial Recombinant Protein (H00003032-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HADHB Partial Recombinant Protein (H00003032-Q01)

Discover more about diseases related to HADHB Partial Recombinant Protein (H00003032-Q01).
 

Pathways for HADHB Partial Recombinant Protein (H00003032-Q01)

View related products by pathway.

PTMs for HADHB Partial Recombinant Protein (H00003032-Q01)

Learn more about PTMs related to HADHB Partial Recombinant Protein (H00003032-Q01).

Blogs on HADHB

There are no specific blogs for HADHB, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HADHB Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HADHB