H2AX Partial Protein

Images

 
SDS-Page: H2AX Partial Protein [H00003014-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE

Order Details

H2AX Partial Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-96 of Human H2AFX partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Protein
Gene
H2AFX
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for H2AX Partial Protein

  • BTF antibHistone H2AX
  • Gamma H2AX
  • H2A histone family member X
  • H2A.FX
  • H2A.X
  • H2A/X
  • H2AFX
  • H2AX histone
  • H2AX
  • Hist5.2ax
  • Histone 2A
  • Histone 2A.X
  • Histone 2AX
  • Histone H2A.x
  • Histone H2A/X
  • Histone H2AFX
  • Histone H2AX
  • Including osteosarcoma
  • OSRC
  • P105 RB
  • P105RB
  • PP105
  • PP110
  • pRb
  • RB 1
  • RB1 protein
  • RB1
  • Retinoblastoma 1 (including osteosarcoma)
  • Retinoblastoma 1
  • Retinoblastoma associated protein
  • Retinoblastoma related osteosarcoma
  • Retinoblastoma susceptibility gene

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-395
Species: Hu, Mu
Applications: IP (-), WB, ICC/IF, PLA
AF2396
Species: Hu
Applications: WB, Simple Western, IHC
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
H00003014-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE

Publications for H2AX Partial Recombinant Protein (H00003014-Q01) (0)

There are no publications for H2AX Partial Recombinant Protein (H00003014-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for H2AX Partial Recombinant Protein (H00003014-Q01) (0)

There are no reviews for H2AX Partial Recombinant Protein (H00003014-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for H2AX Partial Recombinant Protein (H00003014-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I am doing Western blot for H2AX using HL-60 cells, but I do not know which secondary antibody should I use, that is rabbit, mouse or goat?
    • Our lab recommends using a secondary that is appropriate to the primary antibody chosen for your Westerns. Therefore, if you decide to choose a Rabbit polyclonal anti-H2AX antibody, we would recommend an anti-Rabbit IgG secondary conjugated to HRP, or your specific detection system. The host of the secondary should not make a difference in your western blot assay.

Additional H2AX Products

Bioinformatics Tool for H2AX Partial Recombinant Protein (H00003014-Q01)

Discover related pathways, diseases and genes to H2AX Partial Recombinant Protein (H00003014-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for H2AX Partial Recombinant Protein (H00003014-Q01)

Discover more about diseases related to H2AX Partial Recombinant Protein (H00003014-Q01).
 

Pathways for H2AX Partial Recombinant Protein (H00003014-Q01)

View related products by pathway.

PTMs for H2AX Partial Recombinant Protein (H00003014-Q01)

Learn more about PTMs related to H2AX Partial Recombinant Protein (H00003014-Q01).
 

Research Areas for H2AX Partial Recombinant Protein (H00003014-Q01)

Find related products by research area.

Blogs on H2AX.

ATM - detecting and responding to DNA damage
Ataxia telangiectasia mutated (ATM) is essential for the maintenance of genomic stability. ATM is a 370 kDa serine-threonine kinase that is constitutively expressed in various tissues. Although primarily nuclear, ATM is also found at lower levels...  Read full blog post.

Customers Who Bought This Also Bought

53BP1 Antibody
NB100-304
H2AX Antibody
NB100-638
Nbs1 Antibody
NB100-143

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our H2AX Partial Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol H2AFX