H2AX Antibody

Images

 
Western Blot: H2AX Antibody [H00003014-D01P] - Analysis of H2AFX expression in transfected 293T cell line by H2AFX polyclonal antibody.Lane 1: H2AFX transfected lysate(15.10 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

H2AX Antibody Summary

Immunogen
H2AFX (NP_002096.1, 1 a.a. - 143 a.a.) full-length human protein. MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
H2AFX
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for H2AX Antibody

  • BTF antibHistone H2AX
  • Gamma H2AX
  • H2A histone family member X
  • H2A.FX
  • H2A.X
  • H2A/X
  • H2AFX
  • H2AX histone
  • H2AX
  • Hist5.2ax
  • Histone 2A
  • Histone 2A.X
  • Histone 2AX
  • Histone H2A.x
  • Histone H2A/X
  • Histone H2AFX
  • Histone H2AX
  • Including osteosarcoma
  • OSRC
  • P105 RB
  • P105RB
  • PP105
  • PP110
  • pRb
  • RB 1
  • RB1 protein
  • RB1
  • Retinoblastoma 1 (including osteosarcoma)
  • Retinoblastoma 1
  • Retinoblastoma associated protein
  • Retinoblastoma related osteosarcoma
  • Retinoblastoma susceptibility gene

Background

H2A.X is a member of the histone H2A family, 1 of 5 families of histone proteins involved in nucleosomal organization of chromatin. H2A.X is synthesised in G1 as well as S phase and is known to be important for recombination between immunoglobulin switch regions. A very early step in the response of mammalian cells to DNA double-strand breaks is the phosphorylation of histone H2A.X at serine 139 at the sites of DNA damage. There is a predicted acetylation at residue 1 and ubiquitination at reside 119. Phosphorylated H2A.X promotes DNA repair and maintains genomic stability.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-395
Species: Hu, Mu
Applications: IP (-), WB, ICC/IF, PLA
AF2396
Species: Hu
Applications: WB, Simple Western, IHC
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-02456
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
H00003014-D01P
Species: Hu
Applications: WB

Publications for H2AX Antibody (H00003014-D01P) (0)

There are no publications for H2AX Antibody (H00003014-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for H2AX Antibody (H00003014-D01P) (0)

There are no reviews for H2AX Antibody (H00003014-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for H2AX Antibody (H00003014-D01P). (Showing 1 - 1 of 1 FAQ).

  1. I am doing Western blot for H2AX using HL-60 cells, but I do not know which secondary antibody should I use, that is rabbit, mouse or goat?
    • Our lab recommends using a secondary that is appropriate to the primary antibody chosen for your Westerns. Therefore, if you decide to choose a Rabbit polyclonal anti-H2AX antibody, we would recommend an anti-Rabbit IgG secondary conjugated to HRP, or your specific detection system. The host of the secondary should not make a difference in your western blot assay.

Secondary Antibodies

 

Isotype Controls

Additional H2AX Products

Bioinformatics Tool for H2AX Antibody (H00003014-D01P)

Discover related pathways, diseases and genes to H2AX Antibody (H00003014-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for H2AX Antibody (H00003014-D01P)

Discover more about diseases related to H2AX Antibody (H00003014-D01P).
 

Pathways for H2AX Antibody (H00003014-D01P)

View related products by pathway.

PTMs for H2AX Antibody (H00003014-D01P)

Learn more about PTMs related to H2AX Antibody (H00003014-D01P).
 

Research Areas for H2AX Antibody (H00003014-D01P)

Find related products by research area.

Blogs on H2AX.

ATM - detecting and responding to DNA damage
Ataxia telangiectasia mutated (ATM) is essential for the maintenance of genomic stability. ATM is a 370 kDa serine-threonine kinase that is constitutively expressed in various tissues. Although primarily nuclear, ATM is also found at lower levels...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our H2AX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol H2AFX
Uniprot