H2A Antibody (4C10) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related H2A Primary Antibodies

Order Details


    • Catalog Number
      H00008337-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

H2A Antibody (4C10) [PE] Summary

Immunogen
HIST2H2AA (AAH01629, 1 a.a. - 130 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
Specificity
HIST2H2AA - histone 2, H2aa
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HIST2H2AA3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for H2A Antibody (4C10) [PE]

  • H2A histone family, member O
  • H2A.2
  • H2A/O
  • H2A/q
  • H2a-615
  • H2AFOHistone H2A/o
  • HIST2H2AAH2A
  • histone 2, H2aa
  • histone 2, H2aa3
  • histone cluster 2, H2aa3
  • histone H2A type 2-A
  • Histone H2A.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-07996
Species: Hu
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBL1-11569
Species: Hu
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-56633
Species: Hu
Applications: WB
NBP2-48588
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
H00008337-M01PE
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for H2A Antibody (H00008337-M01PE) (0)

There are no publications for H2A Antibody (H00008337-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for H2A Antibody (H00008337-M01PE) (0)

There are no reviews for H2A Antibody (H00008337-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for H2A Antibody (H00008337-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional H2A Products

H2A H00008337-M01PE

Bioinformatics Tool for H2A Antibody (H00008337-M01PE)

Discover related pathways, diseases and genes to H2A Antibody (H00008337-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for H2A Antibody (H00008337-M01PE)

Discover more about diseases related to H2A Antibody (H00008337-M01PE).

Blogs on H2A.

H3.1t - A testis-specific histone variant
Histones are nuclear proteins essential for the storage and organization of genomic DNA as chromatin. Chromatin consists of DNA wrapped tightly around histone oligomers to form nucleosomes. In addition to compacting the genome, histones also regula...  Read full blog post.

H3.1 - A core histone essential for genome storage and organization
Histones are the main protein component of chromatin and are essential for the storage and compaction of the genome. DNA wraps around histone oligomers to make up nucleosomes, the individual subunits of chromatin. By altering the accessibility of t...  Read full blog post.

Histone H3
Eukaryotic chromosomes are formed through the highly organized and structural wrapping of DNA genetic material around histone proteins into the classic "bead on a string" globular structure of nucleosomes. The histone family consists of five family me...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our H2A Antibody (4C10) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol HIST2H2AA3