GUCY2F Antibody

Images

 
Immunohistochemistry: GUCY2F Antibody [NBP1-84327] - Staining of human smooth muscle shows cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Product Discontinued
View other related GUCY2F Primary Antibodies

Order Details


    • Catalog Number
      NBP1-84327
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GUCY2F Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIAQAMNNAMKENGQAGAASLVQHSRNMQFHGFNQLMRTDSNGNGISEYVILDTNLKEWELHSTYTVDMEMELLR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GUCY2F
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GUCY2F Antibody

  • CYGF
  • EC 4.6.1
  • GC-FEC 4.6.1.2
  • guanylate cyclase 2F, retinalRETGC-2
  • Guanylate cyclase F
  • GUC2DL
  • GUC2Fguanylate cyclase 2D-like, membrane (retina-specific)
  • RETGC2
  • retinal guanylyl cyclase 2
  • Rod outer segment membrane guanylate cyclase 2
  • ROS-GC2RetGC-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-55158
Species: Hu
Applications: IHC, IHC-P
NBP2-68721
Species: Hu
Applications: WB, IHC, IHC-P
H00000251-M07
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP, RNAi
H00004882-M02
Species: Hu, Po
Applications: WB, ELISA, IHC, IHC-P
NBP1-31333
Species: Hu, Rt, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11409
Species: Hu
NBP2-86888
Species: Hu
Applications: WB
NBP1-89724
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
NBP2-46201
Species: Hu
Applications: WB, IHC
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB110-74751
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13245
Species: Hu
Applications: IHC, IHC-P
NBP1-84880
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84327
Species: Hu
Applications: IHC, IHC-P

Publications for GUCY2F Antibody (NBP1-84327) (0)

There are no publications for GUCY2F Antibody (NBP1-84327).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GUCY2F Antibody (NBP1-84327) (0)

There are no reviews for GUCY2F Antibody (NBP1-84327). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GUCY2F Antibody (NBP1-84327) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GUCY2F Products

Array NBP1-84327

Bioinformatics Tool for GUCY2F Antibody (NBP1-84327)

Discover related pathways, diseases and genes to GUCY2F Antibody (NBP1-84327). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GUCY2F Antibody (NBP1-84327)

Discover more about diseases related to GUCY2F Antibody (NBP1-84327).
 

Pathways for GUCY2F Antibody (NBP1-84327)

View related products by pathway.

PTMs for GUCY2F Antibody (NBP1-84327)

Learn more about PTMs related to GUCY2F Antibody (NBP1-84327).
 

Research Areas for GUCY2F Antibody (NBP1-84327)

Find related products by research area.

Blogs on GUCY2F

There are no specific blogs for GUCY2F, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GUCY2F Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GUCY2F
COVID-19 update